KEGG   Methanoculleus bourgensis: BN140_1300Help
Entry
BN140_1300        CDS       T02189                                 

Gene name
fbpA
Definition
(GenBank) Fructose-1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg00030  Pentose phosphate pathway
mbg00051  Fructose and mannose metabolism
mbg00680  Methane metabolism
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
mbg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_1300 (fbpA)
   00030 Pentose phosphate pathway
    BN140_1300 (fbpA)
   00051 Fructose and mannose metabolism
    BN140_1300 (fbpA)
  Energy metabolism
   00680 Methane metabolism
    BN140_1300 (fbpA)
Enzymes [BR:mbg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BN140_1300 (fbpA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BN140_1300 (fbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-GeneID: 13355771
NCBI-ProteinID: CCJ36223
UniProt: I7J8P3
Position
1329991..1331088
Genome map
AA seq 365 aa AA seqDB search
MVKTTVSVIKADVGSYPGHSRTHPKLLEVAARMLKEAEGSTIIDSYVTHCGDDLELIMTH
TKGEDNEEIHELAWNVFLECAKIAKEMKLYGAGQDLLADAFSGNVKGMGPGVAEMEFEER
GSDPLLVFMADKTEPGAWNYFLYKIFADPFSTSGLVIDPSMHQGFTFEVHDVMEKRRIRF
NTPEESYSLLAYIGAPSRYVIKYVWKKDGTIAASTSTQRLNMMAGRYVGKDDPVMVIRAQ
SGLPSVGEVIDPFRTPILVAGWMRGSHHGPFMPVGVCDANCTQFDGPPRVVCLGFQVSNG
KLIGPADMFDDPAFNRVRDRCCELSDVLRAHGPFEPHRLSLEEMEYTTLPGVEKQFKDRW
EDLPE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaccaccgtgtccgtgattaaagcagatgtaggtagttatccggggcactcc
cgcacccacccgaagctcctcgaggtggcagcccggatgcttaaggaggcagaaggcagc
acgatcatcgactcgtatgtcacccactgcggtgacgacctcgagctgattatgacgcac
accaagggcgaggataacgaagagatccatgaactggcgtggaacgtcttcctggaatgt
gcgaagatagccaaggaaatgaaactctacggagcgggccaggacctgctcgccgatgcg
ttcagcggcaacgtcaaggggatgggacccggtgttgccgagatggagtttgaagaacgc
ggttccgacccgcttttggtcttcatggctgacaagaccgagccgggtgcgtggaactac
ttcctctacaagatctttgccgatcccttcagcacgtccggcctcgtcatcgacccctcg
atgcaccaggggttcaccttcgaggtccatgatgtcatggagaagcggaggatccggttc
aatacaccggaagagtcatacagtctccttgcctatattggggcaccgagccgttatgtg
atcaagtacgtctggaagaaggacggcacgattgcagcctctacaagcacccagcggctg
aacatgatggccggccggtacgtcggcaaggacgatccggtcatggtcatcagggcacag
agcgggctgccgtcagtcggtgaagtcatcgatcccttcaggacgcccatcctcgtggcc
ggctggatgcgcgggtcgcaccacggccccttcatgccggtgggggtctgtgacgcaaac
tgcacgcagttcgacggaccgccccgggtcgtctgcctcgggttccaggtcagcaatggg
aagctgatcgggcctgcagatatgtttgacgatccggcattcaaccgcgtccgcgaccgg
tgctgcgagctctcagatgtgctccgggcccacgggccgtttgaacctcaccggctctca
cttgaggagatggagtataccaccctcccgggagtcgagaagcagttcaaggaccgctgg
gaagaccttcccgaataa

DBGET integrated database retrieval system