KEGG   Methanoculleus bourgensis: BN140_1300Help
Entry
BN140_1300        CDS       T02189                                 

Gene name
fbpA
Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mbg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbg00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mbg00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mbg00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:mbg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329991..1331088
Genome map
AA seq 365 aa AA seqDB search
MVKTTVSVIKADVGSYPGHSRTHPKLLEVAARMLKEAEGSTIIDSYVTHCGDDLELIMTH
TKGEDNEEIHELAWNVFLECAKIAKEMKLYGAGQDLLADAFSGNVKGMGPGVAEMEFEER
GSDPLLVFMADKTEPGAWNYFLYKIFADPFSTSGLVIDPSMHQGFTFEVHDVMEKRRIRF
NTPEESYSLLAYIGAPSRYVIKYVWKKDGTIAASTSTQRLNMMAGRYVGKDDPVMVIRAQ
SGLPSVGEVIDPFRTPILVAGWMRGSHHGPFMPVGVCDANCTQFDGPPRVVCLGFQVSNG
KLIGPADMFDDPAFNRVRDRCCELSDVLRAHGPFEPHRLSLEEMEYTTLPGVEKQFKDRW
EDLPE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaccaccgtgtccgtgattaaagcagatgtaggtagttatccggggcactcc
cgcacccacccgaagctcctcgaggtggcagcccggatgcttaaggaggcagaaggcagc
acgatcatcgactcgtatgtcacccactgcggtgacgacctcgagctgattatgacgcac
accaagggcgaggataacgaagagatccatgaactggcgtggaacgtcttcctggaatgt
gcgaagatagccaaggaaatgaaactctacggagcgggccaggacctgctcgccgatgcg
ttcagcggcaacgtcaaggggatgggacccggtgttgccgagatggagtttgaagaacgc
ggttccgacccgcttttggtcttcatggctgacaagaccgagccgggtgcgtggaactac
ttcctctacaagatctttgccgatcccttcagcacgtccggcctcgtcatcgacccctcg
atgcaccaggggttcaccttcgaggtccatgatgtcatggagaagcggaggatccggttc
aatacaccggaagagtcatacagtctccttgcctatattggggcaccgagccgttatgtg
atcaagtacgtctggaagaaggacggcacgattgcagcctctacaagcacccagcggctg
aacatgatggccggccggtacgtcggcaaggacgatccggtcatggtcatcagggcacag
agcgggctgccgtcagtcggtgaagtcatcgatcccttcaggacgcccatcctcgtggcc
ggctggatgcgcgggtcgcaccacggccccttcatgccggtgggggtctgtgacgcaaac
tgcacgcagttcgacggaccgccccgggtcgtctgcctcgggttccaggtcagcaatggg
aagctgatcgggcctgcagatatgtttgacgatccggcattcaaccgcgtccgcgaccgg
tgctgcgagctctcagatgtgctccgggcccacgggccgtttgaacctcaccggctctca
cttgaggagatggagtataccaccctcccgggagtcgagaagcagttcaaggaccgctgg
gaagaccttcccgaataa

DBGET integrated database retrieval system