KEGG   Methanoculleus bourgensis: BN140_1312Help
Entry
BN140_1312        CDS       T02189                                 

Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg00620  Pyruvate metabolism
mbg00640  Propanoate metabolism
mbg00680  Methane metabolism
mbg00720  Carbon fixation pathways in prokaryotes
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
Module
mbg_M00357  Methanogenesis, acetate => methane
mbg_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_1312
   00620 Pyruvate metabolism
    BN140_1312
   00640 Propanoate metabolism
    BN140_1312
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_1312
   00680 Methane metabolism
    BN140_1312
Enzymes [BR:mbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BN140_1312
Lipid biosynthesis proteins [BR:mbg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BN140_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 13355375
NCBI-ProteinID: CCJ36235
UniProt: I7KZD9
Position
complement(1345761..1347659)
Genome map
AA seq 632 aa AA seqDB search
MTENFSVKLEEAKYYTPEVRCREQSWMGNYNKTYQAFLADPDGFWDNVARELEWFQPWSR
VKEWDYPYARWFLNGKLNITHNCLDRHAHNQRRNKVALMWRGETEDEERIYTYRQLFQAV
CRFANGLKSLGVGKGDRVCIYMPVVPEQVIAMLACARIGAVHSVVFGGFGVNALNQRIRG
TNAKVVITADVTYRRGRAIPLKNIVEEAVVNAPSVERIVVLRRDTDKPVELHPEMEVDYY
DLVDGESRECPAEPMDAEDPLFILYTSGTTGAPKGIVHACGGYTVGTYYTTKHVFDIRDD
DIYWCTADPGWITGHSYGIYGPLLNGATCLIAEATPDYPTPGTWWDLIEEYGVTIFYTAP
TAIRMFMRVGEEWPNRYNLSSLRILGSVGEPLNPEAFEWFYHTIGKDRCPIVDTWWQTET
GMHMLTTMIGEPMRPGFVGRPIPGVVADVVNRQGKPVPPGTGGLLVIKEPWPSMMRTVWG
DDERYRKYWETIPGCYTAADLAVKDEDGYIMVIGRADDLIVVAGHNIGTAEVESALVSHD
AVAEAAVIGKPDPLKGNTIKAFVILRDGQQPGEKLKKDLIYHVRMTLGPIAIPSEIDFVQ
SLPKTRSGKIMRRVLKAQEMGMDPGDISTLEE
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaatttcagtgtcaaactcgaggaggcgaagtactacactcccgaggtcagg
tgcagggaacagtcctggatgggcaactacaacaagacctaccaggcgttcctggcagac
cccgatggattctgggacaacgtcgccagggagcttgagtggttccagccctggagccgg
gtgaaggagtgggactacccgtatgccagatggttcctgaacgggaaactcaacatcacc
cacaactgcctggaccgccacgctcacaaccagcgacgcaacaaggtcgcgctcatgtgg
cggggtgagaccgaggacgaggagcggatatacacctatcgccagctcttccaggcggtt
tgccggttcgcaaacggcctcaaaagcctcggcgtcgggaagggcgaccgggtctgcatc
tacatgccggtggtgcccgagcaggtcatcgcaatgctggcctgtgcccgtatcggagcc
gtccactcggtcgtcttcggggggttcggcgtcaacgcgctcaaccagcggatccgcggc
accaacgcgaaggtggtcatcaccgccgacgtcacctaccggcgcggcagggcgatcccg
ctcaagaacatcgtcgaagaggcagtcgtcaacgcaccgagcgtggagcggattgttgtt
ctgcggcgcgataccgataaacctgtggaactccaccctgagatggaggttgactactac
gacctggttgacggcgagagccgcgaatgtccggctgaaccgatggatgctgaggacccg
ctcttcattctctacacgagcggcaccaccggagcaccgaagggcatcgtgcatgcctgc
ggcgggtatacggtcggaacctactacacgacgaagcacgtcttcgatatcagggacgat
gatatctactggtgcaccgccgaccccggctggatcaccggccacagttacggcatctac
ggcccgctcctgaacggcgccacctgtctcatcgcggaggcaacccccgattacccgact
ccgggcacctggtgggacctcatcgaggagtacggtgtcactatcttctacaccgcaccg
accgctatccggatgttcatgcgggtgggcgaggagtggccgaatcgctacaacctctcg
tcgctgcgtatcctcgggtcggtcggcgaaccgctcaacccggaggcgttcgaatggttc
taccacaccatcggaaaggacaggtgcccgatcgtggatacctggtggcagaccgagacc
gggatgcacatgctgaccacgatgatcggcgagcccatgcgcccgggattcgtgggaagg
ccgatcccgggtgtcgtcgcggacgtcgtcaaccggcagggcaagccagttccccccggc
acaggcggccttctggtcatcaaggagccctggccgtcgatgatgcggacggtctgggga
gatgacgagcgctaccgtaagtactgggagaccattccggggtgctacaccgcggctgac
ctcgcggtgaaggacgaggacggttacattatggtcatcgggcgtgctgatgacctgatc
gtcgtcgccgggcacaacatcggcaccgcggaggtcgagagcgcgcttgtctcccatgat
gcggtggctgaggcggccgtcatagggaaacccgatcccctgaagggcaacactatcaag
gccttcgtcatcctcagggacggccaacagcccggggagaaactgaagaaagacctcatc
taccatgtccggatgacactcgggcctatcgccataccgtccgagatcgatttcgtccag
tcgctccccaaaacccggagcggcaagatcatgaggcgggtcttaaaagcacaggaaatg
ggcatggacccaggagacatctcgaccctggaggagtga

DBGET integrated database retrieval system