KEGG   Methanoculleus bourgensis: BN140_1312Help
Entry
BN140_1312        CDS       T02189                                 

Definition
acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_1312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_1312
   00620 Pyruvate metabolism
    BN140_1312
   00640 Propanoate metabolism
    BN140_1312
  Energy metabolism
   00680 Methane metabolism
    BN140_1312
Enzymes [BR:mbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BN140_1312
Lipid biosynthesis proteins [BR:mbg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BN140_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1345761..1347659)
Genome map
AA seq 632 aa AA seqDB search
MTENFSVKLEEAKYYTPEVRCREQSWMGNYNKTYQAFLADPDGFWDNVARELEWFQPWSR
VKEWDYPYARWFLNGKLNITHNCLDRHAHNQRRNKVALMWRGETEDEERIYTYRQLFQAV
CRFANGLKSLGVGKGDRVCIYMPVVPEQVIAMLACARIGAVHSVVFGGFGVNALNQRIRG
TNAKVVITADVTYRRGRAIPLKNIVEEAVVNAPSVERIVVLRRDTDKPVELHPEMEVDYY
DLVDGESRECPAEPMDAEDPLFILYTSGTTGAPKGIVHACGGYTVGTYYTTKHVFDIRDD
DIYWCTADPGWITGHSYGIYGPLLNGATCLIAEATPDYPTPGTWWDLIEEYGVTIFYTAP
TAIRMFMRVGEEWPNRYNLSSLRILGSVGEPLNPEAFEWFYHTIGKDRCPIVDTWWQTET
GMHMLTTMIGEPMRPGFVGRPIPGVVADVVNRQGKPVPPGTGGLLVIKEPWPSMMRTVWG
DDERYRKYWETIPGCYTAADLAVKDEDGYIMVIGRADDLIVVAGHNIGTAEVESALVSHD
AVAEAAVIGKPDPLKGNTIKAFVILRDGQQPGEKLKKDLIYHVRMTLGPIAIPSEIDFVQ
SLPKTRSGKIMRRVLKAQEMGMDPGDISTLEE
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaatttcagtgtcaaactcgaggaggcgaagtactacactcccgaggtcagg
tgcagggaacagtcctggatgggcaactacaacaagacctaccaggcgttcctggcagac
cccgatggattctgggacaacgtcgccagggagcttgagtggttccagccctggagccgg
gtgaaggagtgggactacccgtatgccagatggttcctgaacgggaaactcaacatcacc
cacaactgcctggaccgccacgctcacaaccagcgacgcaacaaggtcgcgctcatgtgg
cggggtgagaccgaggacgaggagcggatatacacctatcgccagctcttccaggcggtt
tgccggttcgcaaacggcctcaaaagcctcggcgtcgggaagggcgaccgggtctgcatc
tacatgccggtggtgcccgagcaggtcatcgcaatgctggcctgtgcccgtatcggagcc
gtccactcggtcgtcttcggggggttcggcgtcaacgcgctcaaccagcggatccgcggc
accaacgcgaaggtggtcatcaccgccgacgtcacctaccggcgcggcagggcgatcccg
ctcaagaacatcgtcgaagaggcagtcgtcaacgcaccgagcgtggagcggattgttgtt
ctgcggcgcgataccgataaacctgtggaactccaccctgagatggaggttgactactac
gacctggttgacggcgagagccgcgaatgtccggctgaaccgatggatgctgaggacccg
ctcttcattctctacacgagcggcaccaccggagcaccgaagggcatcgtgcatgcctgc
ggcgggtatacggtcggaacctactacacgacgaagcacgtcttcgatatcagggacgat
gatatctactggtgcaccgccgaccccggctggatcaccggccacagttacggcatctac
ggcccgctcctgaacggcgccacctgtctcatcgcggaggcaacccccgattacccgact
ccgggcacctggtgggacctcatcgaggagtacggtgtcactatcttctacaccgcaccg
accgctatccggatgttcatgcgggtgggcgaggagtggccgaatcgctacaacctctcg
tcgctgcgtatcctcgggtcggtcggcgaaccgctcaacccggaggcgttcgaatggttc
taccacaccatcggaaaggacaggtgcccgatcgtggatacctggtggcagaccgagacc
gggatgcacatgctgaccacgatgatcggcgagcccatgcgcccgggattcgtgggaagg
ccgatcccgggtgtcgtcgcggacgtcgtcaaccggcagggcaagccagttccccccggc
acaggcggccttctggtcatcaaggagccctggccgtcgatgatgcggacggtctgggga
gatgacgagcgctaccgtaagtactgggagaccattccggggtgctacaccgcggctgac
ctcgcggtgaaggacgaggacggttacattatggtcatcgggcgtgctgatgacctgatc
gtcgtcgccgggcacaacatcggcaccgcggaggtcgagagcgcgcttgtctcccatgat
gcggtggctgaggcggccgtcatagggaaacccgatcccctgaagggcaacactatcaag
gccttcgtcatcctcagggacggccaacagcccggggagaaactgaagaaagacctcatc
taccatgtccggatgacactcgggcctatcgccataccgtccgagatcgatttcgtccag
tcgctccccaaaacccggagcggcaagatcatgaggcgggtcttaaaagcacaggaaatg
ggcatggacccaggagacatctcgaccctggaggagtga

DBGET integrated database retrieval system