KEGG   Methanoculleus bourgensis: BN140_1332Help
Entry
BN140_1332        CDS       T02189                                 

Gene name
porB3
Definition
(RefSeq) pyruvate ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_1332 (porB3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_1332 (porB3)
   00020 Citrate cycle (TCA cycle)
    BN140_1332 (porB3)
   00620 Pyruvate metabolism
    BN140_1332 (porB3)
   00640 Propanoate metabolism
    BN140_1332 (porB3)
   00650 Butanoate metabolism
    BN140_1332 (porB3)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_1332 (porB3)
   00680 Methane metabolism
    BN140_1332 (porB3)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN140_1332 (porB3)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BN140_1332 (porB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1371064..1372017
Genome map
AA seq 317 aa AA seqDB search
MPGDKTTKPSLQLMTNIEKRSVNNLSAIPKEEYLFKCTSACAGCSSSLCLRYVLKAAGPD
SVLVVPACCTSVLQGIYPGTAMNVPVYNIAFAAAAACASGMSNAFATLGRKTNVIVYAGD
GGTVDIGIQALSGAFERGTDFLYICYDNEAYGNTGMQRSGSTPLGARTTTTPGGKPTAKK
DLDRIVEAHNPPYMATACSAYPLDLYKKVKKALSIPGPKFIHILAPCPPGWRYPSEKTVE
MGKLAVKTGTWVLYEREFGKLSISGPSKAAMRKPAPLEDYIKGQGRFKNIDPEVLEEMRQ
QVERNIQRLSREEAGIC
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggggacaaaaccacaaaaccctcattacaattaatgacaaatatagagaagagg
agtgtaaacaatttgtccgcgattccgaaggaggagtatctgttcaagtgcacgtccgcc
tgtgcggggtgcagctcttccctgtgtctgcgctacgtgctcaaagcagccggcccggat
tctgtcctggtcgtgcctgcctgctgcaccagcgtcctccaggggatctaccccggcacg
gcgatgaacgtgccggtatataacatagcatttgccgcagccgccgcctgcgcctcaggt
atgagcaatgcgttcgcgacgctcggaaggaagaccaacgtcatcgtctacgcaggagat
ggagggaccgtcgatatcggtattcaggcgctatccggcgctttcgagcgcggcaccgat
ttcctctacatatgctacgacaacgaggcatacggcaacaccggcatgcagcggtcgggc
tcgacgccgctcggggcacgcaccaccacgacccccggcggcaagcccacagccaagaag
gacctcgaccgtatcgtcgaggcgcataaccccccctacatggcgaccgcctgcagcgcc
taccccctcgacctctacaagaaggtgaagaaggcgctctcgattccggggccgaagttc
atccatatccttgcaccgtgtccccccgggtggcgctacccctcggagaagaccgtcgag
atggggaaactcgcggtgaagaccggaacatgggtcctctacgagcgtgagttcgggaaa
ctctccatcagcggcccgtcgaaggcggcgatgaggaagcccgcgcccttggaggactac
atcaagggtcagggccggtttaagaacatagatcctgaggttctcgaagagatgcggcag
caggttgagcgcaacatccagcgcctctcccgcgaggaggccggcatatgctga

DBGET integrated database retrieval system