KEGG   Methanoculleus bourgensis: BN140_1334Help
Entry
BN140_1334        CDS       T02189                                 

Gene name
porC
Definition
pyruvate ferredoxin oxidoreductase, gamma subunit (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_1334 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_1334 (porC)
   00020 Citrate cycle (TCA cycle)
    BN140_1334 (porC)
   00620 Pyruvate metabolism
    BN140_1334 (porC)
   00640 Propanoate metabolism
    BN140_1334 (porC)
   00650 Butanoate metabolism
    BN140_1334 (porC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_1334 (porC)
   00680 Methane metabolism
    BN140_1334 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN140_1334 (porC)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BN140_1334 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373116..1373643
Genome map
AA seq 175 aa AA seqDB search
MYEIRIHSRGGQGGVTAARLLALAAFRDGKYATACPFYGAERRGAPVVSFVRIDDKPIKI
YSQIHEPDLVIVLDASIMDVVDVLQGLKEDGTVLLNSAHALEGCGATCRHVDLTGIALAK
NLVIAGSPILNTPVLGALAKMGVVTLPSVEKAIREMFADERNVQAAEAAYEELKI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagatcaggatccactcccggggcgggcagggcggtgtcaccgccgcccgcctg
cttgccctcgcggcgttccgggacggaaaatacgcaactgcctgtccgttctacggggcg
gaacggcgcggggcgccggtcgtctcgtttgtcaggatagacgataagccgatcaagatc
tacagccagatccacgaaccagatctcgtgatcgtgctcgatgcgagcatcatggacgtc
gtggacgtcctgcagggtctcaaagaggacgggacggtactcttaaacagcgctcacgcg
cttgaggggtgcggcgcgacctgccgccacgtcgacctgaccgggattgcgctcgccaag
aacctggtgatcgccgggagtcccatcctcaacaccccggtgctcggggcgcttgcgaag
atgggcgtcgtcacgctcccgtcggtcgagaaggcgatccgggagatgtttgccgatgag
cggaacgtacaagctgctgaagcggcatatgaggagctgaagatatga

DBGET integrated database retrieval system