KEGG   Methanoculleus bourgensis: BN140_1335Help
Entry
BN140_1335        CDS       T02189                                 

Gene name
porD3
Definition
pyruvate ferredoxin oxidoreductase, delta subunit (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_1335 (porD3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_1335 (porD3)
   00020 Citrate cycle (TCA cycle)
    BN140_1335 (porD3)
   00620 Pyruvate metabolism
    BN140_1335 (porD3)
   00640 Propanoate metabolism
    BN140_1335 (porD3)
   00650 Butanoate metabolism
    BN140_1335 (porD3)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_1335 (porD3)
   00680 Methane metabolism
    BN140_1335 (porD3)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN140_1335 (porD3)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BN140_1335 (porD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373640..1373885
Genome map
AA seq 81 aa AA seqDB search
MRERLALSRPTEASSGKTGSWRTFRPVVDREVCNGCGLCAQYCPDGVIDEELNIDLDYCK
GCGICANECPKEAITMVREER
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgagagagagacttgcgctcagcagacccacggaggcctcttcagggaagacggggtcg
tggcggacgttccggcccgtcgtggacagggaagtctgcaacggctgcgggctctgcgcc
cagtactgcccggacggggtcatcgacgaggaactcaatatcgaccttgattactgcaag
ggctgcggcatctgcgcaaacgagtgcccgaaggaagccatcactatggtgcgggaggag
cgctga

DBGET integrated database retrieval system