KEGG   Methanoculleus bourgensis: BN140_1471Help
Entry
BN140_1471        CDS       T02189                                 

Gene name
hat
Definition
elongator complex protein 3 (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mbg  Methanoculleus bourgensis
Brite
Enzymes [BR:mbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BN140_1471 (hat)
Transfer RNA biogenesis [BR:mbg03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    BN140_1471 (hat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1500952..1502526)
Genome map
AA seq 524 aa AA seqDB search
MMNDTGILREIISRIFSTGPDPDIQRIKLAVCREYSADMPKNSAILAAAAPEERELLRPL
LLVKPTRTLSGVAPVAVMTSPHPCPHGKCLPCPGGPEHPFASPQSYTGEEPAALRAREHA
FDPYDQVQARLGQFEALGHHVDKTELIVMGGTMTARPVEYQEWFVGAAVQAMNDYPQAGV
PAAKPDLDAVFAANETSGVRCVAITFETRPDWCREEHINRMLEMGVTKVELGVQHLDDRI
LDYNRRGHGVAESVEANSLLRDAGLKVGFHMMPNLPGASMEDDRWMFRELFADSRFRPDF
LKIYPTLVTPGSEIEALWERGDYRPYSEDELIDLIAYGKSLLPEYVRLQRIQRDIPAKLI
VAGSRHSNFRQLAGERLCEQGLRCRCIRCREVGRTPAPEEVAVSTYAYASCGGEERFIQA
GSEDALVGFARLRFPHRTFREELSGAALLRELHVYGSVVPLSTPAEGDEWQHRSFGARLL
SRAEEEARGQGFARVAVMSGVGVRPYYRKQGYERVGPYMIKTVV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgataccgggatactccgggagatcatctcccgcatcttttctacggggccc
gaccctgacatccagcggatcaagcttgcggtctgccgggaatacagcgccgatatgccc
aaaaactccgcgattctcgccgcagccgccccggaggagcgcgagctcctccgcccgctc
ctcctcgtgaaacccacccggacgctctccggtgtggcgcctgtcgcggtgatgacatca
ccccacccctgtcctcacgggaaatgcctgccctgcccgggcgggccggagcacccgttc
gcctccccccagagttacacgggcgaggaaccggcggcgctccgggcccgggagcacgcg
ttcgacccctacgaccaggtgcaggcacggctcgggcagtttgaggcgctcggccaccac
gtcgacaagacggagctgatcgtgatgggcgggacgatgaccgcccgaccggtcgaatac
caggagtggttcgtcggggcagccgtgcaggcgatgaacgactacccccaggccggggtc
ccggcggcaaagccggacctggacgcggtctttgccgcgaacgagacgtcgggggtcagg
tgcgtcgcgatcacgttcgagacgaggccggactggtgccgggaggagcatatcaaccgg
atgctcgagatgggggtgaccaaggtggagctcggcgtccagcacctggacgaccggatc
ctcgattacaaccggaggggccacggggtcgcggaatcggtcgaggcaaactctctcctc
cgcgacgccgggctgaaggtcgggttccacatgatgccaaacctccccggggcaagcatg
gaggacgaccgatggatgtttcgggaactcttcgccgattcccggttccgcccggacttt
ctgaagatctacccgaccctggtgacgccaggctctgagatcgaggcgctctgggagcgg
ggcgactaccgcccctactccgaggacgaactgatcgacctcatcgcctatggaaaatcc
ctcctccccgagtacgtccgtctccagcgcatccagcgtgacatcccggcaaaactgatc
gtcgccggttcccggcacagcaacttccggcagcttgccggggagcgtctctgtgagcag
gggctgcggtgccggtgcatcaggtgccgggaggtcggcaggacgcccgcgccggaggag
gtggcggtctcgacgtatgcctacgcgtcatgcggcggggaggagcggttcatccaggcg
ggctctgaggatgcccttgtcgggtttgcccggctccggttcccgcaccgcaccttccgc
gaggaactttccggtgcggcgctcctgcgcgagctccatgtctacgggagcgtggtcccc
ctcagcaccccggcggagggggacgagtggcagcaccgcagtttcggcgcccggctcctc
tcccgcgccgaggaggaggcccgtggccagggttttgcgcgggtcgcggtgatgagcggt
gtcggggtgcggccctactacaggaaacagggatatgaacgagtggggccatatatgatc
aagacagttgtatga

DBGET integrated database retrieval system