KEGG   Methanoculleus bourgensis: BN140_1505Help
Entry
BN140_1505        CDS       T02189                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00260  Glycine, serine and threonine metabolism
mbg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01130  Biosynthesis of antibiotics
mbg01230  Biosynthesis of amino acids
Module
mbg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN140_1505 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN140_1505 (trpB2)
Enzymes [BR:mbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BN140_1505 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 13355916
NCBI-ProteinID: CCJ36428
UniProt: I7J922
Position
1531857..1533215
Genome map
AA seq 452 aa AA seqDB search
MQTKILLDEGEMPKRWYNIQADLPLPLDPPLHPATGKPATPDDLRPIFPMELIRQEMSRE
RYIDIPAEVRDILTLWRPSPLYRARRLEAALKTPAKIYYKWEGVSPPGSHKPNTAIPQAY
YNREEGIERLATETGAGQWGSSLAFATSLFDMECTVYMVRSSYEQKPYRKSMMQVYGAEC
IPSPSLKTRSGRMVLGRDPDTPGSLGIAISEAVEDAASHDNTNYALGSVLNHVCLHQTII
GQEAKQQLAVAEAYPDVVIGCVGGGSNFAGISFPFAGEKITGKHPDIDIIAVEPAACPTL
TKGLYTYDYGDVAGLTPIMKMFTLGHDFVPPAIHAGGLRYHGASPLVSRLAHDGVIRPVA
YYQNEVFEAAVTFARTEGIVVAPEAAHAVKAAIDEALRCRETGEAKVILFNNSGHGNFDF
SSYEAYFAGGLADYEYPVELIKESLSRLPVTG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgaagatcctccttgacgagggggagatgccgaaacggtggtacaacatccag
gccgatcttccactacccctggacccgcccctccacccggcgaccgggaaaccggcaacc
cccgacgacctccgccccatcttcccgatggagctgatcaggcaggagatgagcagagag
cgctacatcgatattccggccgaggtccgggatatcctcaccctctggagaccgagcccc
ctctaccgggcaagaaggcttgaagcggccttgaagaccccggcgaagatctactataag
tgggagggcgtaagcccgccgggctcgcataagcccaacaccgccatcccccaggcctac
tacaaccgcgaggaggggatcgagcggctcgcgaccgagaccggggcggggcagtgggga
tcgtcgcttgcgttcgcaacgagcctctttgatatggaatgcaccgtctacatggtcagg
agctcgtatgagcagaagccctaccggaagagcatgatgcaggtctacggcgccgagtgc
atcccgagcccgtcgctgaagacccggtcgggccggatggtgctcggccgcgaccccgac
accccgggctccctcggtatcgccatatcagaagcggtcgaggacgcggcgagccacgat
aacaccaactacgcgctcggctcagtcctcaaccatgtctgcctccaccagacgatcatc
ggccaggaggcaaagcagcagctcgcggttgcggaggcctaccctgacgtcgtgatcggg
tgcgtcggcggcggctcgaacttcgctgggatctcgttcccgtttgcaggcgaaaagatc
acgggaaagcaccccgatatcgatatcatcgcggtagagcctgcagcatgcccgaccctg
acgaaggggctctacacctacgactacggtgatgtcgcggggctgaccccgatcatgaag
atgttcaccctcggccacgacttcgtcccgcctgcgatccatgcgggcggcctgcgctac
cacggggcgtcgccgctcgtatccaggctcgcccacgacggcgtcatcaggccggtcgcc
tactaccagaacgaggtcttcgaggctgccgtgaccttcgcccggaccgaggggatcgtc
gtcgcgcccgaggcggcccacgcggtgaaggccgcgatcgacgaggccctcaggtgccgg
gagaccggcgaggcaaaggtgatcctcttcaacaactccgggcacggcaacttcgacttc
tcctcctacgaagcctatttcgcgggagggctggccgactacgagtacccggtggagctg
atcaaagagtcgctctcccggctgccggtgacggggtga

DBGET integrated database retrieval system