KEGG   Methanoculleus bourgensis: BN140_1505Help
Entry
BN140_1505        CDS       T02189                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN140_1505 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN140_1505 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN140_1505 (trpB2)
Enzymes [BR:mbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BN140_1505 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1531857..1533215
Genome map
AA seq 452 aa AA seqDB search
MQTKILLDEGEMPKRWYNIQADLPLPLDPPLHPATGKPATPDDLRPIFPMELIRQEMSRE
RYIDIPAEVRDILTLWRPSPLYRARRLEAALKTPAKIYYKWEGVSPPGSHKPNTAIPQAY
YNREEGIERLATETGAGQWGSSLAFATSLFDMECTVYMVRSSYEQKPYRKSMMQVYGAEC
IPSPSLKTRSGRMVLGRDPDTPGSLGIAISEAVEDAASHDNTNYALGSVLNHVCLHQTII
GQEAKQQLAVAEAYPDVVIGCVGGGSNFAGISFPFAGEKITGKHPDIDIIAVEPAACPTL
TKGLYTYDYGDVAGLTPIMKMFTLGHDFVPPAIHAGGLRYHGASPLVSRLAHDGVIRPVA
YYQNEVFEAAVTFARTEGIVVAPEAAHAVKAAIDEALRCRETGEAKVILFNNSGHGNFDF
SSYEAYFAGGLADYEYPVELIKESLSRLPVTG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgaagatcctccttgacgagggggagatgccgaaacggtggtacaacatccag
gccgatcttccactacccctggacccgcccctccacccggcgaccgggaaaccggcaacc
cccgacgacctccgccccatcttcccgatggagctgatcaggcaggagatgagcagagag
cgctacatcgatattccggccgaggtccgggatatcctcaccctctggagaccgagcccc
ctctaccgggcaagaaggcttgaagcggccttgaagaccccggcgaagatctactataag
tgggagggcgtaagcccgccgggctcgcataagcccaacaccgccatcccccaggcctac
tacaaccgcgaggaggggatcgagcggctcgcgaccgagaccggggcggggcagtgggga
tcgtcgcttgcgttcgcaacgagcctctttgatatggaatgcaccgtctacatggtcagg
agctcgtatgagcagaagccctaccggaagagcatgatgcaggtctacggcgccgagtgc
atcccgagcccgtcgctgaagacccggtcgggccggatggtgctcggccgcgaccccgac
accccgggctccctcggtatcgccatatcagaagcggtcgaggacgcggcgagccacgat
aacaccaactacgcgctcggctcagtcctcaaccatgtctgcctccaccagacgatcatc
ggccaggaggcaaagcagcagctcgcggttgcggaggcctaccctgacgtcgtgatcggg
tgcgtcggcggcggctcgaacttcgctgggatctcgttcccgtttgcaggcgaaaagatc
acgggaaagcaccccgatatcgatatcatcgcggtagagcctgcagcatgcccgaccctg
acgaaggggctctacacctacgactacggtgatgtcgcggggctgaccccgatcatgaag
atgttcaccctcggccacgacttcgtcccgcctgcgatccatgcgggcggcctgcgctac
cacggggcgtcgccgctcgtatccaggctcgcccacgacggcgtcatcaggccggtcgcc
tactaccagaacgaggtcttcgaggctgccgtgaccttcgcccggaccgaggggatcgtc
gtcgcgcccgaggcggcccacgcggtgaaggccgcgatcgacgaggccctcaggtgccgg
gagaccggcgaggcaaaggtgatcctcttcaacaactccgggcacggcaacttcgacttc
tcctcctacgaagcctatttcgcgggagggctggccgactacgagtacccggtggagctg
atcaaagagtcgctctcccggctgccggtgacggggtga

DBGET integrated database retrieval system