KEGG   Methanoculleus bourgensis: BN140_1512Help
Entry
BN140_1512        CDS       T02189                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN140_1512 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN140_1512 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN140_1512 (trpA)
Enzymes [BR:mbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BN140_1512 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1538780..1539568
Genome map
AA seq 262 aa AA seqDB search
MSRLSAAFAGRNGPTFVGFLVAGDPDPATSLTVAKAMIDAGAGILEVAVPFSDPMADGPV
IQQAHERALAAGMTPDATFDLVRAIRGYAPVPVVLFTYANIVFRQGWDRFAVRAAGAGAD
GLLVVDLPPEESGDLSAAAARHGLDLIRLIAPTTSAARRRQILAGASGFVYLVAVEGVTG
VRDNLPAHLAGLIGTLRQETDLPLAVGFGVSRPGHVRAIATAGADAVVVGSAVVRVIGES
PGGGEEMVQAVRDYVAGMTGRP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggctctccgccgcattcgcgggccggaacggtccgacattcgtcgggttcctg
gtcgccggagaccctgacccggcaacgtcgcttaccgtcgcgaaggcgatgatcgatgcc
ggggccggtatcctcgaggtcgccgtccccttctctgaccccatggccgacggcccggtc
atccagcaggcccacgagcgggcgctcgccgccgggatgaccccggatgcgacgttcgac
ctggtgcgggcgatccggggttacgccccggtgccggtcgtcctctttacgtatgcaaac
atcgtcttccggcaggggtgggaccggttcgccgtccgggccgcgggggcgggggccgac
ggccttctggtcgtcgacctcccgcccgaagagtccggggacctctcggcagccgcggcc
cggcatggtcttgacctcatcaggctcatcgccccgacgacatcggcggcccgccggcgg
cagatcctcgccggtgcgtcggggttcgtctacctggtcgcggtcgagggggtgaccggt
gtccgggacaacctcccggcgcaccttgcaggcctgatcgggacactcaggcaggagaca
gacctcccgcttgccgtcgggttcggggtctcccggcccgggcacgtccgggcgatagcg
accgccggtgcggacgcggtcgtcgtcgggagcgccgttgtccgggtcatcggggagagc
cccggcggcggggaggagatggtgcaggcggtccgggactacgttgccgggatgacgggg
cggccatga

DBGET integrated database retrieval system