KEGG   Methanoculleus bourgensis: BN140_1629Help
Entry
BN140_1629        CDS       T02189                                 

Gene name
asnB1
Definition
(GenBank) asparagine synthase (glutamine-hydrolysing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00250  Alanine, aspartate and glutamate metabolism
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN140_1629 (asnB1)
Enzymes [BR:mbg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BN140_1629 (asnB1)
Peptidases [BR:mbg01002]
 Cysteine Peptidases
  Family C44
   BN140_1629 (asnB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-GeneID: 13356006
NCBI-ProteinID: CCJ36552
UniProt: I7LK27
Position
1655229..1657031
Genome map
AA seq 600 aa AA seqDB search
MCGIAGQFVLNGGEADADLVGAMAERLRHRGPDGEGTCFSGPVGLAHRRLAIIDLSDEGR
QPMANEDGSLWIVFNGEVYNYLELREDLRALGHRFATATDTEVVLHAYEEWGRDCLHRFN
GMWAFAIWDNRRRELFCARDRLGVKPLYYTLAGGSFLFASEIKALLAHPAVGRKPNDRML
ATFLAWGVADHTGETMYDGIFQLPPAHSIVVSVEGAGEPERYWDLVMNAAPGGADDDAAA
GRVRDLLTDAVRLRLRSDVPVGTCLSGGIDSSTVTFLINDLLRAERPESVGDRQKTFSVC
FDDPRFDESRHIDTVVAATEVASHRITPDTEGLWEDIGRLLYMQDEPFASLSIYAQYCVM
RLASDEVKVVLDGQGADEQLAGYIAYQMPYVRGLLRQGRVLAALREAVGGARHHRSFFSW
AIRQSLVRSERRELLRGDAPEVLRYAGSLDEVLAREITASNLPLLLHWEDRNSMAFSIEA
RVPFLDYRLVEYLAGLPLDQKIRGGVTKYVLRRAIRGLVPDAVRCRMDKMGFVTPEEVWM
KDELRPHILDLFSTPEFSRRPFWDAERVLQNYREFLDGKSEYSTEFWRIACAEVWLRQFD
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgccgggcagtttgtcctgaacgggggggaggcggatgcggacctcgtc
ggggccatggcggagcggctccgccaccgcgggcctgacggcgagggaacctgcttctcc
ggtccggttgggcttgcccatcgccgtcttgcgatcatcgacctctccgacgaaggccgg
cagccgatggcaaacgaggacgggtcgctctggatcgtcttcaacggcgaggtctacaac
tacctggaactcagggaagacctcagggctctcggccaccggttcgccaccgcgaccgat
accgaggtggtcctgcacgcctacgaggagtgggggcgggactgcctgcaccggttcaat
gggatgtgggcctttgctatctgggacaatcgccgccgcgaactcttctgtgcccgggac
cgcctgggcgtaaaaccgttgtactataccctggccggggggtcgttcctcttcgcgtcg
gagatcaaggcgctgctcgcgcatcccgcggtcggccggaagcccaacgaccggatgctt
gcgacgtttcttgcgtggggggttgcggaccataccggggagacgatgtacgacgggatc
ttccagcttccgccggctcactctatcgtcgtctcggtcgagggtgccggggagccggag
cgctactgggatcttgtgatgaacgctgcccccgggggggctgacgacgatgccgccgcg
gggagggtccgcgacctcctgaccgatgcggtcaggctcaggctccggagcgacgtcccg
gtcgggacctgtctctcgggggggatcgactcctcgacggtcaccttcctgatcaacgac
ctcctgcgggcggagcgcccggagagcgtcggcgaccggcagaagacgttctcggtctgt
ttcgacgatcccaggttcgacgagagcaggcatatcgacacggtggttgcggcgacggag
gtcgcgagccaccggataactcccgatacggaggggctctgggaggatatcgggcggctg
ctctacatgcaggatgagccgtttgcgtcgctctcgatatacgcccagtactgcgtgatg
cggcttgcgagcgacgaggtgaaggttgtcctcgacgggcagggggccgatgagcagctg
gccgggtatatcgcctaccagatgccgtatgtcagggggctgttgcggcagggccgggtc
cttgcggcgctccgggaggccgtcgggggcgcacggcaccaccggtcattcttttcgtgg
gcaatccgtcagtctcttgtccggtcggagcggagggagcttctccggggggacgcgccc
gaggtcctcaggtacgcgggatcgcttgacgaggtgctcgcacgggagatcacggcctca
aacctccccctcctgctgcactgggaggaccgcaactcaatggccttctcgatcgaggcc
cgggtcccgttcctcgactataggctcgtggagtacctcgcggggctcccgctcgaccag
aagatccggggcggggtcacgaagtacgtgctgcggcgggcgatccgggggctggtcccg
gacgccgtccggtgcaggatggacaagatgggttttgtcacgcccgaggaggtctggatg
aaggacgaactccgcccccatatccttgacctcttctcaacgccggagttttcccggcgg
cccttctgggacgcggagcgggtgctccaaaactaccgggagttcctcgacgggaagagc
gagtactccaccgagttctggcggatcgcctgcgccgaggtctggctgcggcagtttgat
tga

DBGET integrated database retrieval system