KEGG   Methanoculleus bourgensis: BN140_1665Help
Entry
BN140_1665        CDS       T02189                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mbg  Methanoculleus bourgensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BN140_1665 (deoA)
Enzymes [BR:mbg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BN140_1665 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1690558..1692081
Genome map
AA seq 507 aa AA seqDB search
MKLTVKLLDIANRGVLLHSTDAQNIRVRDGDRVQIADETAGISVQAHVDTTSSLIEPGVI
GVYRPLNATLAASEGTPVEVRSAERPLSLSYIKKKMDGGRFTKDETLEIVKDIVDDTLSP
GEITAYVTASYINGLDMDEVEYLTRAMVETGERLQFTRHPVVDKHSIGGVPGNKITLLIV
PIIAASGLRIPKTSSRAITGAGGTADLMEVLAPVSFPAAEVQKMTEKVGGAIVWGGATNI
APADDKIITYEYPFRIDARGQMIASVMAKKFAVGADIVVIDIPVGRNTKIATPQEGRKLA
REFIELGERLGMRVECALSYGESLVGHTIGPNLEVHEALAVLEGAPEPNSLIQKSLSIAG
IALEMAGKAAYGQGFDMAADLLRSGKALEKMRQIIEVQGGDPTVKAEDIVPGEYRFDVRA
PQDGYVIELNNSALVTLARLAGSPYDHGAGLDIHAKKGTRVRKGDPIFTIYADREWRLER
AIEVGRVLMPVVVEGMVLERIPPERWV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacagtgaaactgctcgacatcgcgaaccggggggtcctcctccacagcacc
gacgcgcaaaacatccgggtccgcgacggcgaccgtgtccagatcgccgacgagacagcc
ggaataagcgtccaggcccacgtcgacaccaccagttctctcatcgagcccggtgtcatc
ggcgtttaccggccgctgaacgccacgctcgccgcaagcgagggaacacccgtcgaggtg
cggagcgccgagcggccgctatccctctcgtatatcaagaagaagatggacggcggccgg
tttaccaaggacgagaccctggagatcgtcaaggatattgtcgacgacaccctctcgccc
ggcgagatcactgcctacgtcaccgcatcctacatcaacggcctcgacatggacgaggta
gagtacctgacgagagccatggtcgagaccggggagcgcctccagttcacccggcacccg
gtcgtcgacaagcactccatcgggggcgtgcccgggaacaagatcaccctcctgatcgtg
ccgatcatcgccgcgagcggtctccggatcccaaagaccagctcccgcgccatcaccggc
gccggcgggaccgcggacctcatggaggttcttgcgcccgtctcgttcccggcggccgag
gtccagaagatgaccgagaaggtcggcggcgccatcgtctggggcggggccacgaacatc
gcccctgccgacgacaagatcatcacctacgagtacccgttccggatcgacgcccggggg
cagatgatcgcaagcgtcatggccaagaagttcgccgtcggcgccgatatcgtggtcatc
gatataccggtcggccggaacacaaagattgcgacaccccaggagggccgcaaactcgcc
cgcgagttcatcgaactcggtgagaggctcggcatgcgggtcgagtgcgcgctcagttac
ggggagtcgctcgtcggtcacaccatcggcccgaacctcgaggtgcacgaggcgctcgcc
gtcctcgagggggcgcctgagccgaactccctgatccagaagagcctctcgattgccggg
attgcgctcgagatggcagggaaggctgcatacggccaggggttcgacatggcggccgac
ctcctccggagcgggaaggcgcttgagaagatgcggcagatcatcgaggttcagggcggc
gacccgacggtgaaggccgaggatatcgttcccggagagtaccggttcgatgtccgggcc
ccgcaggacggctacgtcatcgaactcaacaacagcgcgctcgtgaccctcgcccggctt
gcgggctccccctatgatcacggcgcggggcttgatatccacgcaaagaagggaacccgg
gtcaggaagggcgatcctatcttcactatctacgctgaccgggagtggcgacttgagcgc
gcgatagaggtcggcagggtgctgatgccggtggtcgtggaggggatggtccttgagcgt
atcccgcctgagcgctgggtataa

DBGET integrated database retrieval system