KEGG   Methanoculleus bourgensis: BN140_1824Help
Entry
BN140_1824        CDS       T02189                                 

Definition
F420-0:gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mbg  Methanoculleus bourgensis
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mbg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1871977..1872726)
Genome map
AA seq 249 aa AA seqDB search
MEIQVIGVQGLPLIRKGDDLPALICDRVTFEDGDILTIASSVYSKAKGFTRDLATITPSA
DAVRIAAKTKEDPRFVQAVLDSSSDILLEHPFILSEVPSGHIGVRAGVDHSNIEDGRIII
LPPDPMGAAAEIRDAIQRITKKDVRVIITDTCGRSFRRGQTGIAIGWAGMTAINDYRGDT
DLFGHVLEITEEAVVDEIAAFANFLMGESHQGVPAVVFRNCRVWNGHDAVYFTPEEDIVR
AALKKSKKD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagatccaggtaatcggtgttcagggcctccccctgatccgaaaaggtgacgacctt
ccggccctgatctgcgatcgggtcacgtttgaagatggagatatcctcaccatcgcctcg
tccgtctactcaaaggcaaagggtttcacccgcgaccttgccactatcaccccgagcgcc
gacgccgtgcggattgccgcaaagacaaaggaggacccccgattcgtgcaggcggtcctg
gactcgtcaagcgacatcctgctcgaacacccgttcatcctctcagaggtgccttccggc
cacatcggtgtgcgcgcgggcgtcgaccacagcaacatcgaagacggccggatcatcatc
ctcccgcccgaccccatgggggccgccgccgagatccgggacgcaatccagcgcatcaca
aaaaaggatgtcagggttatcatcaccgatacctgtgggcggtcgtttaggcgcggccag
accggtatcgccataggatgggcgggaatgacagcgatcaacgactaccggggcgacacc
gacctcttcggccacgtcctcgagatcaccgaagaagcagtggtcgacgagattgcagcc
ttcgcgaactttctcatgggcgaaagtcaccagggcgttcccgccgtggtcttccgtaac
tgcagggtctggaacgggcatgatgcagtctacttcacacccgaggaggacatcgtcagg
gccgccctgaagaagagcaaaaaggattag

DBGET integrated database retrieval system