KEGG   Methanoculleus bourgensis: BN140_1940Help
Entry
BN140_1940        CDS       T02189                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mbg  Methanoculleus bourgensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN140_1940
Enzymes [BR:mbg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BN140_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2004881..2005423)
Genome map
AA seq 180 aa AA seqDB search
MLDQEFERIGKRLFLEGLVGANFGNMSVRAKAGLYITRSGAYLDAREMPAFVPEDGEAPP
EASSEYRVHRAVYQETPHRAIVHAHPVHAVAASLDADLLRPVDSEGGMLCPEIPVVGGEP
GTDEIARNVAEALRGGHIVIVRGHGTFAAGKTLDEAYIYTSIAEYSCRILFLSGRSGRVL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaccaggagtttgaacggatagggaaacgcctctttctcgaaggccttgtagga
gcgaattttgggaacatgagtgtgcgcgctaaagcggggttgtacatcacccggtccggc
gcctacctggatgcccgggagatgccggcatttgtgccggaagacggggaggcgccacca
gaagcctcaagcgagtaccgggtccaccgggcagtctaccaggagaccccgcaccgtgcg
attgtccatgcccacccggtccatgccgtcgccgcttcgctcgatgccgacctgctccgg
ccggttgacagtgaaggcgggatgctctgcccggagatcccggtcgtcgggggagaaccg
gggaccgatgagattgcccggaacgtcgcagaagcactccgtggcggccacatcgttatc
gtccgcgggcacggaacgtttgccgccggaaaaacgctggatgaggcgtatatctacacc
tctattgccgagtactcctgccggatcctcttcctatcggggcggtctgggcgggttctg
taa

DBGET integrated database retrieval system