KEGG   Methanoculleus bourgensis: BN140_2031Help
Entry
BN140_2031        CDS       T02189                                 

Definition
triosephosphate isomerase (TIM) (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_2031
   01230 Biosynthesis of amino acids
    BN140_2031
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2031
   00051 Fructose and mannose metabolism
    BN140_2031
   00562 Inositol phosphate metabolism
    BN140_2031
Enzymes [BR:mbg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BN140_2031
Exosome [BR:mbg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BN140_2031
  Exosomal proteins of bladder cancer cells
   BN140_2031
  Exosomal proteins of melanoma cells
   BN140_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2090983..2091651)
Genome map
AA seq 222 aa AA seqDB search
MVSPLILVNLKTYHEGMGQNAHRIAAAAETVGRESGVVIGIAPVFTEIRPMSQHYAIPVY
AQHIDAITPGAHTGHILPEEVRAAGAHGTLINHSERRLTLADIDACVQASRRLRLESVVC
TNNDSTSAAAAALRPDYVAIEPPELIGSGVSVSKADPGIIERSVNAVRAVNPDVRVLTGA
GIQSGECVKIAVDLGTSGVLLASSVVKADDPEAVLRDLVSLI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaccgttgattctggtcaatctgaagacctaccatgagggtatgggccaaaac
gctcaccggatcgccgctgcggccgagaccgtggggagagagagcggggttgtcatcggc
atcgcgccggtcttcaccgagatccgcccgatgagccagcactatgcaataccggtctat
gcccagcatatcgacgcgatcactcccggcgcccataccggccatattctgcctgaagag
gtcagggcggcgggcgcacacggcaccctgatcaaccactccgaacgccgcctcaccctg
gccgatatcgacgcctgtgtccaggcatcccggaggctccgccttgaatcggtcgtctgc
acgaacaacgactccaccagtgccgccgcagcagcgctccggcccgactacgtggcgatc
gagcccccggagctgatcgggagtggggtctcggtctcgaaggccgaccccgggatcatc
gagcgctccgtcaacgcagtcagggccgtgaacccggacgtgagagtcctgaccggggcg
gggatccagtcaggcgagtgcgtaaaaatagcagtcgaccttggaacctccggggtcctg
ctggcgtcaagcgttgtcaaagccgacgaccccgaggcggttctccgggaccttgtctcg
ctgatctag

DBGET integrated database retrieval system