KEGG   Methanoculleus bourgensis: BN140_2181Help
Entry
BN140_2181        CDS       T02189                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg00030  Pentose phosphate pathway
mbg00051  Fructose and mannose metabolism
mbg00052  Galactose metabolism
mbg00680  Methane metabolism
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
mbg01230  Biosynthesis of amino acids
mbg03018  RNA degradation
Module
mbg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2181 (pfkA)
   00030 Pentose phosphate pathway
    BN140_2181 (pfkA)
   00051 Fructose and mannose metabolism
    BN140_2181 (pfkA)
   00052 Galactose metabolism
    BN140_2181 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BN140_2181 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BN140_2181 (pfkA)
Enzymes [BR:mbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BN140_2181 (pfkA)
Protein phosphatases and associated proteins [BR:mbg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BN140_2181 (pfkA)
Messenger RNA biogenesis [BR:mbg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BN140_2181 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 13355210
NCBI-ProteinID: CCJ37104
UniProt: I7LNH8
Position
2291960..2292931
Genome map
AA seq 323 aa AA seqDB search
MRRIGILTSGGDAPGMNACIRAAVRTALAHDLAIVGIRRGYTGLIGADTIPLDRAAIRNT
IHLGGTILETSRNPDFYTRDGRLRAAAAIERMGLDGLVLIGGEGTFHGASLLAADADTAA
LVGVPGSIDNDVYGTDYCIGFDTAANCAVEAIDRIRDTARSHERLFFIEVMGRTTGFLAL
ESGIAGGAEELAIPEEQVSVARMSERIREGFSIGKKSAIVVVAEGKTPGISFHLAREVKK
HLDFDSRVVVLGHLQRGGPPTLRDRVLGSLLGVAAVEALLEGRSGCMVGEVGGELAYTPL
EETWQKKKPLNEDLRRIFTILSD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcatcggcatcctaacgagcggcggcgacgccccgggcatgaacgcctgcatc
agggctgcggtgcggacagcgcttgcgcatgacctcgccatcgtcgggatacgccggggg
tataccgggctcatcggcgccgatacgataccgctggaccgcgctgcgatcagaaacacc
atccacctcggcggcactatccttgagacatcccggaaccctgacttctacacaagggat
gggaggcttcgggcggcggctgccatcgagcggatggggcttgacggcctggtcctgatc
ggaggcgaagggacattccacggtgcaagcctgcttgccgccgatgctgacacagcagcg
ctcgtgggggtgccggggagcatcgacaacgatgtctacgggaccgattactgcataggg
ttcgatacggcggcaaactgtgcggttgaggctatcgaccgcatccgcgacacggcccgg
tcccacgagcggctcttcttcatcgaggtgatgggacggacgaccggctttttggcgctc
gagagcggtatcgccggcggtgccgaggaactggccatcccggaagagcaggtctcagtc
gcccggatgagcgagcgcatacgggaggggttttccatcggaaagaagagcgcgattgtt
gtggtggctgaggggaagacgcccggcatctccttccaccttgcccgggaggtcaagaag
caccttgacttcgactcccgcgtcgtcgtcctcgggcacctccagcggggcgggccgccg
acgctccgcgaccgggtgctcgggagcctcctcggtgtcgccgccgtcgaggcgctgctt
gagggccggagtgggtgcatggtaggagaggtcgggggagaacttgcgtacacgccgctc
gaggagacatggcaaaagaagaaaccgctcaacgaggacctgcggcggatatttacgatc
ctctctgattag

DBGET integrated database retrieval system