KEGG   Methanoculleus bourgensis: BN140_2181Help
Entry
BN140_2181        CDS       T02189                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_2181 (pfkA)
   01230 Biosynthesis of amino acids
    BN140_2181 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2181 (pfkA)
   00030 Pentose phosphate pathway
    BN140_2181 (pfkA)
   00051 Fructose and mannose metabolism
    BN140_2181 (pfkA)
   00052 Galactose metabolism
    BN140_2181 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BN140_2181 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BN140_2181 (pfkA)
Enzymes [BR:mbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BN140_2181 (pfkA)
Protein phosphatases and associated proteins [BR:mbg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BN140_2181 (pfkA)
Messenger RNA biogenesis [BR:mbg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BN140_2181 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2291960..2292931
Genome map
AA seq 323 aa AA seqDB search
MRRIGILTSGGDAPGMNACIRAAVRTALAHDLAIVGIRRGYTGLIGADTIPLDRAAIRNT
IHLGGTILETSRNPDFYTRDGRLRAAAAIERMGLDGLVLIGGEGTFHGASLLAADADTAA
LVGVPGSIDNDVYGTDYCIGFDTAANCAVEAIDRIRDTARSHERLFFIEVMGRTTGFLAL
ESGIAGGAEELAIPEEQVSVARMSERIREGFSIGKKSAIVVVAEGKTPGISFHLAREVKK
HLDFDSRVVVLGHLQRGGPPTLRDRVLGSLLGVAAVEALLEGRSGCMVGEVGGELAYTPL
EETWQKKKPLNEDLRRIFTILSD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcatcggcatcctaacgagcggcggcgacgccccgggcatgaacgcctgcatc
agggctgcggtgcggacagcgcttgcgcatgacctcgccatcgtcgggatacgccggggg
tataccgggctcatcggcgccgatacgataccgctggaccgcgctgcgatcagaaacacc
atccacctcggcggcactatccttgagacatcccggaaccctgacttctacacaagggat
gggaggcttcgggcggcggctgccatcgagcggatggggcttgacggcctggtcctgatc
ggaggcgaagggacattccacggtgcaagcctgcttgccgccgatgctgacacagcagcg
ctcgtgggggtgccggggagcatcgacaacgatgtctacgggaccgattactgcataggg
ttcgatacggcggcaaactgtgcggttgaggctatcgaccgcatccgcgacacggcccgg
tcccacgagcggctcttcttcatcgaggtgatgggacggacgaccggctttttggcgctc
gagagcggtatcgccggcggtgccgaggaactggccatcccggaagagcaggtctcagtc
gcccggatgagcgagcgcatacgggaggggttttccatcggaaagaagagcgcgattgtt
gtggtggctgaggggaagacgcccggcatctccttccaccttgcccgggaggtcaagaag
caccttgacttcgactcccgcgtcgtcgtcctcgggcacctccagcggggcgggccgccg
acgctccgcgaccgggtgctcgggagcctcctcggtgtcgccgccgtcgaggcgctgctt
gagggccggagtgggtgcatggtaggagaggtcgggggagaacttgcgtacacgccgctc
gaggagacatggcaaaagaagaaaccgctcaacgaggacctgcggcggatatttacgatc
ctctctgattag

DBGET integrated database retrieval system