KEGG   Methanoculleus bourgensis: BN140_2190Help
Entry
BN140_2190        CDS       T02189                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_2190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2190
   00620 Pyruvate metabolism
    BN140_2190
   00640 Propanoate metabolism
    BN140_2190
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_2190
   00680 Methane metabolism
    BN140_2190
Enzymes [BR:mbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BN140_2190
Lipid biosynthesis proteins [BR:mbg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BN140_2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2300568..2302451
Genome map
AA seq 627 aa AA seqDB search
MKNQKGDILHHRIVCMVRYSVTMDDDLVKKIDTICSSLAMSRSEWLNDLCIKHLDGASGS
GVQAMVSAVIPSESGPGHNMIDYDAAYANFSIDVPEYFNFGYDVIDRWAERDRNKLAMIW
VGQQGEEKKYSFRDLKNLSNGAANILLKYGIKRGDRVMLMLPRIPEWWIFVIALIKLGAV
FCPCPTMLTPKDIKYRIRAGKFRMIITDYENATKIDEIADACPLLETLFLADGERDGWAS
YPHELKYPAPVSRRTVSMPVAKKTRATDPMLIYFTSGTTGEPKMVLHNHAYPLGHIVTAS
LWQDVTVNDLHLTFSDTGWAKCAWGKIFGQWIAGACLLVYDIRGKFSATELLPIIERYEV
TTFCAPPTVYRMLILADLDKFDFRDLRHCCSAGEPLNPEVIRVWQYGTGQVIYEGYGQTE
TVCCIGTFPCMEHKPGSMGKPVPGWHIELHDDDGNPVEVGEEGRIAVRLNPRPVGLFVEY
LDNPEANQASFQNGFYYTGDKASMDEDGYFWFVGRNDDVIKSSGYRIGPFEVESALLEHP
AVQESAVVGSPDLIRGMIVKAFIVLKPGYQPSESLVKELQAHVRKITAPYKYPRAIEFVQ
ELPKTLSGKIQRNVLRDQELQKHTNGN
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaaggtgatatcctgcaccacagaatagtatgtatggtgcgatactcg
gtcacgatggatgatgaccttgtgaagaagatcgatacgatctgcagttctcttgcgatg
tcccggtccgaatggctcaacgacctctgcatcaagcacctggatggtgcgtcgggcagc
ggcgtgcaggccatggtctcggcggtgattccgtccgaaagcgggccggggcacaatatg
attgattatgatgccgcctacgccaacttctcgatcgacgttcctgagtacttcaacttc
ggctacgacgtcatcgaccggtgggctgagcgggaccggaataaactggcgatgatctgg
gtgggccagcagggagaggagaagaagtactccttccgcgatctcaagaatctctccaac
ggtgccgcgaacatcctgctcaagtatggtatcaagagaggcgaccgggtcatgctgatg
ctcccgaggatcccggagtggtggatctttgttatcgcgctcatcaaactcggggcggtc
ttctgcccctgcccgacgatgctgaccccgaaggatatcaaataccgtatccgggccggg
aagttcaggatgatcatcaccgattacgaaaacgccacaaagatcgacgagatcgccgac
gcctgcccgctgcttgagaccctcttcctggcggacggggagcgggacggctgggcgagt
tacccgcacgagctcaaataccctgcaccggtatcgcgccgcacggtcagcatgccggtt
gcgaagaagacccgggcgaccgatccgatgctgatttacttcacctccggcaccaccggt
gagcccaagatggtgctgcacaaccacgcctacccgctcggacacatcgtgaccgcatca
ctctggcaggacgtcacggtaaacgaccttcacctgaccttctctgacaccggatgggcg
aaatgcgcctggggcaagatcttcggccagtggatcgccggcgcctgcctcctcgtctat
gacatcagggggaagttctcggcgaccgagttgctcccgattatagagaggtacgaggtg
accacgttctgcgcaccgccgacggtctaccggatgctgatccttgccgacctcgataag
ttcgacttccgggacctccggcactgctgcagcgccggcgaacccctgaaccccgaggtg
atccgtgtctggcagtacggcaccgggcaggtcatctacgagggctacggccagaccgag
accgtctgctgcatcggtacgttcccctgtatggagcataaacccggctccatggggaaa
cccgttcccggctggcatatcgagctccacgatgacgatggaaacccggtcgaagtcggt
gaggaaggaaggattgctgtcaggctcaacccccgcccggtcgggctctttgtggagtac
ctggataaccctgaagcgaaccaggcatcgttccagaatgggttctactacaccggcgat
aaggcaagcatggatgaggacggctacttctggttcgtcgggcgtaacgacgacgtcatc
aagtcttccggctaccgtatcgggccctttgaggtggagagcgcgctcctcgaacacccc
gctgtacaggaatcggcggtcgtcgggtcaccggatctcatccgggggatgatcgtcaag
gcgttcatcgtgctgaaacccggctaccagccgtctgagtcgctagtcaaggaactccag
gcgcatgtcaggaagatcaccgccccgtacaagtatccgagagccatcgagtttgttcaa
gagctcccaaagaccttatccgggaagatccagcgcaacgtcctccgggatcaggaactg
cagaagcacaccaacggtaactga

DBGET integrated database retrieval system