KEGG   Methanoculleus bourgensis: BN140_2246Help
Entry
BN140_2246        CDS       T02189                                 

Definition
fructose-bisphosphate aldolase, class I (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mbg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbg00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mbg00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mbg00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:mbg00680]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mbg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2366166..2367086
Genome map
AA seq 306 aa AA seqDB search
MPPAPDIRIPLDVPSEEQERYRENYRKITHGTGRLMLFAGDQKIEHLNDDFAGEGIHPDD
ADPEHLFRIASRGRVGVFATQLGLIARYGRDYPDVPYLVKLNSKTNLVGTSQSDPVSSEL
YHVRQAVDLRDRAGLSILGVGYTVYLGSEYEPLMLYQAAQIVNQAHRYGLITVLWMYPRG
KAVKDERDPHLVAGAAGVAAAIGSDFAKVNPPKVGGSVDAALLREAVAAAGRTGVVCAGG
SQASVPEFLQQLHDQIHVGGTVGNATGRNIHQRSLDEAVRFCNAISAITLDDAGVDEAMR
IYGGGG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccacctgcacccgatatcaggatccctctcgatgtgccctccgaggagcaggagagg
taccgggagaactaccggaagataacgcacggcaccgggaggctgatgctctttgccggg
gaccagaagatcgagcacctcaacgatgacttcgccggggaaggcatccacccggacgat
gccgaccccgaacacctctttcggatcgcaagcaggggaagggtcggggtctttgcgacg
caactcgggttgatcgcccggtacggcagggattacccggacgtgccctacctggtcaaa
ctcaactccaagaccaacctggtcgggacctcccagagcgacccggtcagttcggaactc
taccatgtccggcaggcggttgacctccgggaccgggccggtctctcgatcctcggcgtc
ggctacacggtctaccttgggagtgagtacgagccgctgatgctctaccaggcagcacag
atcgtcaaccaggcgcacagatacggtctcatcaccgtgctctggatgtacccccgcggc
aaggctgtcaaagacgagcgcgacccgcacctggtcgcgggcgcggcgggggtcgcggcg
gcgatcgggagcgactttgcgaaggtgaacccgccaaaggttggggggtcggtcgatgcg
gcgctcctccgtgaggcggtggcggccgccggcaggaccggagtcgtctgtgcgggcggg
tcgcaggccagcgtgcctgagttcctgcagcagctccacgaccagatccacgtcggcggc
acggtcgggaacgcgaccgggcggaacatccaccagcggtcgcttgacgaggcggttcgg
ttctgcaacgcgatatcggcgatcaccctcgacgacgcgggagtggatgaggcgatgagg
atctatggaggaggtgggtga

DBGET integrated database retrieval system