KEGG   Methanoculleus bourgensis: BN140_2246Help
Entry
BN140_2246        CDS       T02189                                 

Definition
fructose-bisphosphate aldolase, class I (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_2246
   01230 Biosynthesis of amino acids
    BN140_2246
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2246
   00030 Pentose phosphate pathway
    BN140_2246
   00051 Fructose and mannose metabolism
    BN140_2246
  Energy metabolism
   00680 Methane metabolism
    BN140_2246
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN140_2246
Enzymes [BR:mbg01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     BN140_2246
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BN140_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2366167..2367087
Genome map
AA seq 306 aa AA seqDB search
MPPAPDIRIPLDVPSEEQERYRENYRKITHGTGRLMLFAGDQKIEHLNDDFAGEGIHPDD
ADPEHLFRIASRGRVGVFATQLGLIARYGRDYPDVPYLVKLNSKTNLVGTSQSDPVSSEL
YHVRQAVDLRDRAGLSILGVGYTVYLGSEYEPLMLYQAAQIVNQAHRYGLITVLWMYPRG
KAVKDERDPHLVAGAAGVAAAIGSDFAKVNPPKVGGSVDAALLREAVAAAGRTGVVCAGG
SQASVPEFLQQLHDQIHVGGTVGNATGRNIHQRSLDEAVRFCNAISAITLDDAGVDEAMR
IYGGGG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccacctgcacccgatatcaggatccctctcgatgtgccctccgaggagcaggagagg
taccgggagaactaccggaagataacgcacggcaccgggaggctgatgctctttgccggg
gaccagaagatcgagcacctcaacgatgacttcgccggggaaggcatccacccggacgat
gccgaccccgaacacctctttcggatcgcaagcaggggaagggtcggggtctttgcgacg
caactcgggttgatcgcccggtacggcagggattacccggacgtgccctacctggtcaaa
ctcaactccaagaccaacctggtcgggacctcccagagcgacccggtcagttcggaactc
taccatgtccggcaggcggttgacctccgggaccgggccggtctctcgatcctcggcgtc
ggctacacggtctaccttgggagtgagtacgagccgctgatgctctaccaggcagcacag
atcgtcaaccaggcgcacagatacggtctcatcaccgtgctctggatgtacccccgcggc
aaggctgtcaaagacgagcgcgacccgcacctggtcgcgggcgcggcgggggtcgcggcg
gcgatcgggagcgactttgcgaaggtgaacccgccaaaggttggggggtcggtcgatgcg
gcgctcctccgtgaggcggtggcggccgccggcaggaccggagtcgtctgtgcgggcggg
tcgcaggccagcgtgcctgagttcctgcagcagctccacgaccagatccacgtcggcggc
acggtcgggaacgcgaccgggcggaacatccaccagcggtcgcttgacgaggcggttcgg
ttctgcaacgcgatatcggcgatcaccctcgacgacgcgggagtggatgaggcgatgagg
atctatggaggaggtgggtga

DBGET integrated database retrieval system