KEGG   Methanoculleus bourgensis: BN140_2273Help
Entry
BN140_2273        CDS       T02189                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mbg  Methanoculleus bourgensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN140_2273
Enzymes [BR:mbg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BN140_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2399419..2400915
Genome map
AA seq 498 aa AA seqDB search
MNRRGSGVLLHITSLPSVYGIGDLGPAAHRFVDLLAGAGQRYWQILPLNPTCPDLGNSPY
LSTSAFAGNTWLISPEQMVIDGLLGPEDIGDPPGFPEDRVDYRAVMDYKNNLFDRAFERF
RERGPDFRYKEFAAGNVSWLDDYAIFVALRERFEGKVWGDWPPDIRDRHQDALHAYGTEL
ADRILREKFLQYVFDRQWKTLKNHCRSRHLQVIGDLPVYLTYDSVDLWANPDLFKLDEQK
KPAVVAGVPPDAFSATGQLWGNPVYNWEAHLEQEFAWWESRIDRTLALVDRVRLDHFRGF
VQYWEVPVDEMTAENGRWVDAPGRDLFTLLARSRSCLPIIAEDLGYITSDVHEMMAHFGF
PGMKVLIFGFSGDVARNPHAPHNITGGCIAYTGTHDNNTVRGWFEHEVSGDQRDLLFRYI
GGTFGADHAHRILIRLAMLSPAETVIVPMQDILGLGEEARMNRPGTAEGNWEWRLRREQM
REQAMQEFSEVTGLYGRK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcggggcagcggggttctcctccatatcacatcgctgccgtcggtgtacggc
atcggcgaccttggtccggcagcgcaccggttcgtggacctccttgccggggcggggcaa
cgttactggcagattctccccctcaacccgacatgcccggacctcggtaactcgccctac
ctgagcacctcggcgtttgccgggaacacctggctcatcagcccggagcagatggtcatc
gacggtctcctcgggcctgaggatatcggggatccgcccggcttcccggaggaccgggtg
gactaccgggcggtcatggactacaagaacaaccttttcgaccgggcgttcgagcggttc
agggagcggggtccggacttccgctacaaggagtttgcagccgggaacgtctcgtggctt
gatgactacgccatattcgtcgccctcagggaacggttcgaggggaaggtctggggcgac
tggccgcccgatatcagggaccggcaccaggatgccctgcacgcctacggtaccgaactt
gcggaccggatcctcagggagaagttcctccagtacgtttttgaccgtcagtggaagacg
ctcaagaatcactgccgctcaaggcacctccaggtcatcggggacctcccggtctacctc
acctacgacagcgtcgatctctgggcaaacccggatctcttcaaactggatgagcagaag
aaaccggccgttgtcgcgggcgtccccccggatgccttcagcgcgaccgggcagctctgg
ggaaaccccgtctacaactgggaagcgcacctggagcaggagtttgcatggtgggagagc
aggatcgaccgcaccctcgccctcgtcgaccgggtgcgcctcgaccatttccgggggttt
gtgcagtactgggaggtgccggttgatgagatgaccgcagagaacgggcgctgggtcgat
gcacccggccgggacctcttcaccctgctcgcccggagcaggtcgtgcctccccatcatc
gctgaagacctcggctacataacctctgatgtccacgagatgatggcccattttgggttc
ccggggatgaaggtcctgatcttcggcttctccggcgacgtcgcgcgaaacccgcacgcg
cctcacaacatcacaggaggatgcatcgcctacacggggacgcacgacaacaacaccgtc
agggggtggttcgagcacgaggtctcgggcgatcagagggatctcctgttccgctacatc
gggggcacgttcggcgccgaccatgcgcaccgaattctcatccgcctggcgatgctctcc
cccgccgagaccgtgattgtcccgatgcaggacatcctcggtcttggcgaagaggcgcgg
atgaaccgcccgggcacggccgagggaaactgggagtggcggctccgccgggaacagatg
cgggagcaggccatgcaggagttttccgaggttaccgggctctacgggcggaagtga

DBGET integrated database retrieval system