KEGG   Methanoculleus bourgensis: BN140_2598Help
Entry
BN140_2598        CDS       T02189                                 

Definition
N-acylmannosamine kinase (EC:2.7.1.60)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_2598
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2598
   00052 Galactose metabolism
    BN140_2598
   00500 Starch and sucrose metabolism
    BN140_2598
   00520 Amino sugar and nucleotide sugar metabolism
    BN140_2598
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN140_2598
   00524 Butirosin and neomycin biosynthesis
    BN140_2598
Enzymes [BR:mbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BN140_2598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2768461..2769429)
Genome map
AA seq 322 aa AA seqDB search
MPVVRVIREEMTAAIAVDLGGTNLRAALVDSDATILVHTATRTPTTGPSGQVITAAIIAR
IEALLETTEGREVTAIGVASAGPLDLGRGWVTNSPNIAFPVVEITGPLSEQFGLPVALIN
DARAGILGECWAGAARGSEDAVYVTLSTGIGGGVVANGHLLLGMSGNAGEIGHILVDTRY
NLTCGCGYRGHWEGYASAKYVPRFFAAWREEVDVRRVAFDATSTRAIFEAARAGDPVALA
FMDALGQVNARGISTIIVAYNPEVIVLDGPLARYYGEIVIGHAEPYIDRFLTLPRIVVSD
LAGRAPLLGAAAYALKRTGAGP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggtccgcgtaattcgagaagagatgactgccgcgattgccgttgacctcggc
gggaccaacctccgcgccgccctggtcgattcagatgcaaccatcctggtccataccgcc
accagaaccccgaccaccgggccttccgggcaggtgatcaccgccgcgatcatagcaagg
atcgaggcgctcctcgagaccacggagggaagagaggtcacggccatcggcgtcgcatcg
gcagggccgctcgacctcggccgcggatgggtcacgaactccccgaacatcgcgtttccg
gtcgtggagatcaccggtccgctcagcgagcagttcgggctcccggtcgccctgatcaac
gacgccagggccggcattctcggcgagtgctgggctggcgcagcccgcggctcagaggac
gcggtctacgtcaccctctccaccggcatcggcggcggtgtggtggcaaacggccacctc
ctgctcgggatgagcgggaacgccggcgagatcgggcatatcctcgtcgatacccgctac
aacctcacctgcgggtgcggctaccggggccattgggaaggctacgcctcggcaaagtac
gtcccccggttctttgcggcgtggcgggaggaggtcgatgtccgccgggtagccttcgac
gcaacctccacccgcgcgatatttgaggcggcccgggccggggacccggtcgccctcgcg
ttcatggatgcgctcgggcaggtgaacgcccgcgggatatcgaccatcatcgtcgcctac
aatccagaggtgatcgtgctcgacggaccgctcgcccgctactacggggagatcgtgatc
gggcacgcagagccctatatcgaccgcttcctcaccctcccccggatcgtcgtctcagac
ctcgcaggaagggcgccgctcctgggtgcggctgcctacgcgctgaagaggacaggagca
ggaccatga

DBGET integrated database retrieval system