KEGG   Methanoculleus bourgensis: BN140_2612Help
Entry
BN140_2612        CDS       T02189                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (NAD(P))
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
mbg01230  Biosynthesis of amino acids
Module
mbg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mbg_M00002  Glycolysis, core module involving three-carbon compounds
mbg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2612 (gap)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     BN140_2612 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N TrkA_N 2-Hacid_dh_C Sacchrp_dh_NADP NAD_binding_3 Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 13354720
NCBI-ProteinID: CCJ37535
UniProt: I7L1N5
Position
2782725..2783750
Genome map
AA seq 341 aa AA seqDB search
MIKVAINGYGTIGKRVADAVAAQPDMEVIGVSKTSVSSEAYIAKERGYPLYIADLSKKSA
FEKAGIEVAGDVDAMLKAADIVVDATPGGVGEKNRPIYERLGKKAIFQGGEEHEVAGFSF
NAHANYKEAAGKQFARVVSCNTTGLVRLIHALDQAFGVQRVRAVMVRRGADPDDIKRGPI
DAIVLNPATIPSHHGPDVQTVLPQINIVTLAMIVPTTFMHMHSIQADLKTATTRDEVLAV
FENHSRIGLIRKATGIKSNAQLREYTQDLGRPRTDLWENGVFEESVSVLDGKEFYCFQAI
HQEADVIPENIDCIRALMGTVKDPEESIRMTNEALGLVAIG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtcgcaatcaacggctacggcaccatcggcaaacgggtcgccgatgcggtc
gccgcacagccagatatggaagttataggggtctcgaagacgagcgtctcttctgaggcg
tatatcgcaaaagagcgcgggtatcccctgtacatcgccgacctctcgaagaagtcggcg
ttcgagaaggccggcatcgaggtcgcaggcgacgtggatgcgatgctgaaggctgccgac
atcgtcgtggacgccacccccggcggcgtcggggagaagaacagaccaatctatgagcgc
ctcggcaagaaggcaatcttccagggcggcgaggagcacgaggtcgccgggttctccttc
aacgcccacgcgaactacaaagaggctgcaggaaagcagtttgcccgggtcgtctcgtgc
aacaccaccgggctcgtccggctcatccatgccctggaccaggccttcggcgtccagcgg
gtcagggcggtgatggtcaggcgcggagctgaccccgacgacatcaagcgtggaccaatc
gacgccatcgtcctcaacccggccaccatcccgagccaccacggccccgacgtccagacc
gtcctcccgcagatcaacatcgtcaccctcgcgatgatcgtcccgacgacattcatgcac
atgcactcaatacaggcggacctgaagaccgcgaccacccgggacgaggttcttgctgtc
tttgagaaccacagccgcatcgggcttatccgcaaggccaccgggatcaagagcaacgcc
cagctccgggagtacacccaggacctcggcaggcccagaaccgacctctgggagaacggc
gtcttcgaggaatcggtctcggtgcttgatgggaaggagttctactgcttccaggccatc
caccaggaagccgacgtcatccccgagaacatcgactgtatccgggccctgatggggacg
gtgaaggatccggaagagtctatccggatgaccaacgaggcgctcggcctcgtcgccatc
ggatga

DBGET integrated database retrieval system