KEGG   Methanoculleus bourgensis: BN140_2612Help
Entry
BN140_2612        CDS       T02189                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:mbg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2782724..2783749
Genome map
AA seq 341 aa AA seqDB search
MIKVAINGYGTIGKRVADAVAAQPDMEVIGVSKTSVSSEAYIAKERGYPLYIADLSKKSA
FEKAGIEVAGDVDAMLKAADIVVDATPGGVGEKNRPIYERLGKKAIFQGGEEHEVAGFSF
NAHANYKEAAGKQFARVVSCNTTGLVRLIHALDQAFGVQRVRAVMVRRGADPDDIKRGPI
DAIVLNPATIPSHHGPDVQTVLPQINIVTLAMIVPTTFMHMHSIQADLKTATTRDEVLAV
FENHSRIGLIRKATGIKSNAQLREYTQDLGRPRTDLWENGVFEESVSVLDGKEFYCFQAI
HQEADVIPENIDCIRALMGTVKDPEESIRMTNEALGLVAIG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtcgcaatcaacggctacggcaccatcggcaaacgggtcgccgatgcggtc
gccgcacagccagatatggaagttataggggtctcgaagacgagcgtctcttctgaggcg
tatatcgcaaaagagcgcgggtatcccctgtacatcgccgacctctcgaagaagtcggcg
ttcgagaaggccggcatcgaggtcgcaggcgacgtggatgcgatgctgaaggctgccgac
atcgtcgtggacgccacccccggcggcgtcggggagaagaacagaccaatctatgagcgc
ctcggcaagaaggcaatcttccagggcggcgaggagcacgaggtcgccgggttctccttc
aacgcccacgcgaactacaaagaggctgcaggaaagcagtttgcccgggtcgtctcgtgc
aacaccaccgggctcgtccggctcatccatgccctggaccaggccttcggcgtccagcgg
gtcagggcggtgatggtcaggcgcggagctgaccccgacgacatcaagcgtggaccaatc
gacgccatcgtcctcaacccggccaccatcccgagccaccacggccccgacgtccagacc
gtcctcccgcagatcaacatcgtcaccctcgcgatgatcgtcccgacgacattcatgcac
atgcactcaatacaggcggacctgaagaccgcgaccacccgggacgaggttcttgctgtc
tttgagaaccacagccgcatcgggcttatccgcaaggccaccgggatcaagagcaacgcc
cagctccgggagtacacccaggacctcggcaggcccagaaccgacctctgggagaacggc
gtcttcgaggaatcggtctcggtgcttgatgggaaggagttctactgcttccaggccatc
caccaggaagccgacgtcatccccgagaacatcgactgtatccgggccctgatggggacg
gtgaaggatccggaagagtctatccggatgaccaacgaggcgctcggcctcgtcgccatc
ggatga

DBGET integrated database retrieval system