KEGG   Methanoculleus bourgensis: BN140_2612Help
Entry
BN140_2612        CDS       T02189                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_2612 (gap)
   01230 Biosynthesis of amino acids
    BN140_2612 (gap)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2612 (gap)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     BN140_2612 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2782725..2783750
Genome map
AA seq 341 aa AA seqDB search
MIKVAINGYGTIGKRVADAVAAQPDMEVIGVSKTSVSSEAYIAKERGYPLYIADLSKKSA
FEKAGIEVAGDVDAMLKAADIVVDATPGGVGEKNRPIYERLGKKAIFQGGEEHEVAGFSF
NAHANYKEAAGKQFARVVSCNTTGLVRLIHALDQAFGVQRVRAVMVRRGADPDDIKRGPI
DAIVLNPATIPSHHGPDVQTVLPQINIVTLAMIVPTTFMHMHSIQADLKTATTRDEVLAV
FENHSRIGLIRKATGIKSNAQLREYTQDLGRPRTDLWENGVFEESVSVLDGKEFYCFQAI
HQEADVIPENIDCIRALMGTVKDPEESIRMTNEALGLVAIG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtcgcaatcaacggctacggcaccatcggcaaacgggtcgccgatgcggtc
gccgcacagccagatatggaagttataggggtctcgaagacgagcgtctcttctgaggcg
tatatcgcaaaagagcgcgggtatcccctgtacatcgccgacctctcgaagaagtcggcg
ttcgagaaggccggcatcgaggtcgcaggcgacgtggatgcgatgctgaaggctgccgac
atcgtcgtggacgccacccccggcggcgtcggggagaagaacagaccaatctatgagcgc
ctcggcaagaaggcaatcttccagggcggcgaggagcacgaggtcgccgggttctccttc
aacgcccacgcgaactacaaagaggctgcaggaaagcagtttgcccgggtcgtctcgtgc
aacaccaccgggctcgtccggctcatccatgccctggaccaggccttcggcgtccagcgg
gtcagggcggtgatggtcaggcgcggagctgaccccgacgacatcaagcgtggaccaatc
gacgccatcgtcctcaacccggccaccatcccgagccaccacggccccgacgtccagacc
gtcctcccgcagatcaacatcgtcaccctcgcgatgatcgtcccgacgacattcatgcac
atgcactcaatacaggcggacctgaagaccgcgaccacccgggacgaggttcttgctgtc
tttgagaaccacagccgcatcgggcttatccgcaaggccaccgggatcaagagcaacgcc
cagctccgggagtacacccaggacctcggcaggcccagaaccgacctctgggagaacggc
gtcttcgaggaatcggtctcggtgcttgatgggaaggagttctactgcttccaggccatc
caccaggaagccgacgtcatccccgagaacatcgactgtatccgggccctgatggggacg
gtgaaggatccggaagagtctatccggatgaccaacgaggcgctcggcctcgtcgccatc
ggatga

DBGET integrated database retrieval system