KEGG   Mycoplasma bovis Hubei-1: MMB_0080Help
Entry
MMB_0080          CDS       T01568                                 

Gene name
fba
Definition
fructose-bisphosphate aldolase (Fba)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mbh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbh00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mbh00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mbh00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:mbh00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97113..97988
Genome map
AA seq 291 aa AA seqDB search
MPEKYTLTNAKDILLDAKKNKYAVPHVNINNLEWTKNILVTANELRSPVILGTSMGAIKY
MGGFKTVASLVKSLVSDLKISVPVVLHLDHGDFESCFKAIEAGFTSVMFDGSMLSMDENL
ERTKAVVEFAKRFNVSVEAEVGAIGGEEDGIASAGVISNVSDALKMKETGIDVLAAGIGN
IHGKYPESWKSLDFETLSKISNATDIGIVLHGGSGIPTEQVVKAISLGVTKINVNTELQL
AFADAVEKFVLSGESKKGKNFDPRKLLATGCKAICETVKEKIVIFNSQNRY
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaaatacacacttactaatgcaaaagatattttgttagatgctaagaaaaat
aaatatgctgttccacacgtaaatataaataatctagagtgaaccaaaaacattttggtt
actgctaacgaattaagatctcctgttattttaggtacaagtatgggagcaattaaatat
atgggtggttttaaaactgttgcttcattagttaagtcattagttagtgacttaaaaatt
tctgtgccagttgttctccatttagatcatggagattttgaatcatgttttaaagcaatt
gaggctggttttacttcagttatgtttgatggttcaatgctttctatggatgaaaattta
gaaagaactaaagccgttgtagaatttgcaaagagatttaatgtctcagttgaagccgaa
gttggtgctattggcggcgaagaagatggaattgcatctgctggcgttatttcgaatgtt
tctgatgcacttaagatgaaggaaacaggtatagatgttttagctgctggaattggcaat
atccatggtaagtatcccgaatcatgaaaatcattggactttgaaacattaagcaaaatt
tctaatgctactgatataggaatagttttacatggcggcagcggaattccaactgagcaa
gttgttaaagctataagcctaggggttacaaaaattaatgtaaatacggaattgcaatta
gcttttgcggacgcagtggaaaaatttgtgttatctggcgaatctaaaaagggcaagaac
tttgacccaagaaaactattagctaccggatgcaaagctatatgtgaaacagtaaaagag
aaaattgttatattcaattcacaaaatagatactaa

DBGET integrated database retrieval system