KEGG   Mycoplasma bovis Hubei-1: MMB_0080Help
Entry
MMB_0080          CDS       T01568                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase (Fba)
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
mbh00010  Glycolysis / Gluconeogenesis
mbh00030  Pentose phosphate pathway
mbh00051  Fructose and mannose metabolism
mbh00680  Methane metabolism
mbh01100  Metabolic pathways
mbh01110  Biosynthesis of secondary metabolites
mbh01120  Microbial metabolism in diverse environments
mbh01130  Biosynthesis of antibiotics
mbh01200  Carbon metabolism
mbh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMB_0080 (fba)
   00030 Pentose phosphate pathway
    MMB_0080 (fba)
   00051 Fructose and mannose metabolism
    MMB_0080 (fba)
  Energy metabolism
   00680 Methane metabolism
    MMB_0080 (fba)
Enzymes [BR:mbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MMB_0080 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase ThiG Urocanase_C DUF1611_N
Motif
Other DBs
NCBI-ProteinID: AEI89794
Position
97113..97988
Genome map
AA seq 291 aa AA seqDB search
MPEKYTLTNAKDILLDAKKNKYAVPHVNINNLEWTKNILVTANELRSPVILGTSMGAIKY
MGGFKTVASLVKSLVSDLKISVPVVLHLDHGDFESCFKAIEAGFTSVMFDGSMLSMDENL
ERTKAVVEFAKRFNVSVEAEVGAIGGEEDGIASAGVISNVSDALKMKETGIDVLAAGIGN
IHGKYPESWKSLDFETLSKISNATDIGIVLHGGSGIPTEQVVKAISLGVTKINVNTELQL
AFADAVEKFVLSGESKKGKNFDPRKLLATGCKAICETVKEKIVIFNSQNRY
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaaatacacacttactaatgcaaaagatattttgttagatgctaagaaaaat
aaatatgctgttccacacgtaaatataaataatctagagtgaaccaaaaacattttggtt
actgctaacgaattaagatctcctgttattttaggtacaagtatgggagcaattaaatat
atgggtggttttaaaactgttgcttcattagttaagtcattagttagtgacttaaaaatt
tctgtgccagttgttctccatttagatcatggagattttgaatcatgttttaaagcaatt
gaggctggttttacttcagttatgtttgatggttcaatgctttctatggatgaaaattta
gaaagaactaaagccgttgtagaatttgcaaagagatttaatgtctcagttgaagccgaa
gttggtgctattggcggcgaagaagatggaattgcatctgctggcgttatttcgaatgtt
tctgatgcacttaagatgaaggaaacaggtatagatgttttagctgctggaattggcaat
atccatggtaagtatcccgaatcatgaaaatcattggactttgaaacattaagcaaaatt
tctaatgctactgatataggaatagttttacatggcggcagcggaattccaactgagcaa
gttgttaaagctataagcctaggggttacaaaaattaatgtaaatacggaattgcaatta
gcttttgcggacgcagtggaaaaatttgtgttatctggcgaatctaaaaagggcaagaac
tttgacccaagaaaactattagctaccggatgcaaagctatatgtgaaacagtaaaagag
aaaattgttatattcaattcacaaaatagatactaa

DBGET integrated database retrieval system