KEGG   Mycoplasma bovis Hubei-1: MMB_0223Help
Entry
MMB_0223          CDS       T01568                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mbh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MMB_0223
Enzymes [BR:mbh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MMB_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(258325..260550)
Genome map
AA seq 741 aa AA seqDB search
MEMKSFIGYIKEFTNNSDENWPVANFYILKTRKTIKISGNISRMLDKSLYKIEVSEIDDN
SESANNIKTYKCNFYQSLTVIDNQTFFEYLKSDAFNKVADDDFINILKSYYESDDILKEI
LANKEKFLAIKRVQKCILESIFNKLNITALQIEFNVNGLDLDVLVKLTELYNGSFDQIIK
AIKNDLFEINFQHEITNLESIDKIFLHFNNDANNVVRIAYYLHYYCNQILNNKSSTYTSL
ENVKKCFYDENKFFIPAEQKEQIVNDAIKYALNKELLLIKENKVYTTQTYNDEMTIASFL
AKKSRVKKIGSYKFKKYIREIQKETNIENFKYDKSQINALRKFINNKFVVITGGPGTGKT
TLIKGLVKLFKKVHPNESFKIATPTGRAAARIKESFKESNAVTIHKLLQYDDSTGKFRKN
VFNPLDDGLLIIDETSMVDNNLFSHFISAIGEAKRVVFVGDIEQLPSIGIGNAFEDIIKS
KKITTVELKSTHRQKVQSKITELAYMIRNNNFNITKLQETTENSDLKTIFVDNQKQCLNE
IIKNYHINDSDKAGNDSDISYNIQIISPLNKGDLGIKKINNSIQEKFNKNKAKKLNAKDY
SFYEDDKVMYLKNQGDLSNGDIGVIKSISIGESKSKINAFFNKKEIQLNNADLSNLALCY
ACTVHKTQGSEFQKVILVLDPEISGSFINKKLVYTAITRAKKELVIIAGEQSFIKSINQR
PAKRDTTLTEAIRLMYRKKEK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaaatcatttataggttatataaaagaatttactaataattcagatgaaaac
tgacctgttgctaatttttatattttaaagacaaggaaaactattaaaattagtggaaat
atcagcagaatgctagataagagtttatataaaattgaagtaagtgaaattgatgacaat
tcagaatcagcaaataatattaagacttataaatgtaatttttatcaatcattaactgtt
attgacaatcaaactttttttgaatatttgaaatctgatgcatttaataaagttgctgat
gatgattttattaatatattaaaatcatattatgaatcagatgatatcttaaaagaaata
cttgcaaataaagaaaaatttctagccattaagcgtgtacaaaagtgtattttagaaagc
atttttaataaacttaacattactgctttgcaaatagaatttaatgttaatggccttgat
ttagatgtactagttaaattaacagaactatataatggctcgtttgatcaaataataaaa
gcaattaagaatgatttatttgaaattaattttcaacatgaaataactaatttagaatct
atagataaaatctttttgcactttaataatgatgcaaataatgttgtaagaattgcttat
tatttgcattattattgcaaccaaattctaaataataaatctagtacttatacaagttta
gaaaatgtaaaaaaatgtttttatgatgaaaacaagttttttattcccgcagagcaaaaa
gaacaaattgttaatgatgcaataaagtatgctttaaataaagaactgcttttaattaaa
gaaaacaaagtttatacaactcaaacatataatgatgaaatgactattgcttcattttta
gctaaaaaaagcagagttaaaaaaattggttcttataaatttaaaaaatatatacgagaa
attcaaaaagaaacaaacatagaaaactttaaatatgataaaagccaaattaatgcatta
aggaaatttattaataataagtttgtagtaatcaccggtgggcctggaactggcaaaact
actttaataaaaggtttagtaaaactatttaaaaaagttcacccaaatgaaagttttaaa
atagcaacgccaacaggaagagcagccgcaagaattaaagagagttttaaagaatctaat
gctgtaactattcataaattgttgcaatatgatgattcaaccggtaaatttagaaaaaat
gtattcaatcctttggatgatggtttattaattattgatgaaacttcaatggttgataat
aatttatttagtcactttatttcagctattggagaggcaaaaagagtagtttttgttggt
gacatagagcaattaccaagtattggaattggcaatgcatttgaagatattattaaatct
aaaaaaataacaactgttgaattaaaaagcacacaccgtcaaaaagttcaaagtaagatt
actgaattagcttatatgattagaaataataatttcaatattacaaaacttcaagaaaca
acagaaaatagcgatttaaaaactatttttgttgataatcaaaaacaatgcttaaatgaa
attattaaaaattatcatattaatgatagtgataaagccggtaatgattctgatatttca
tataatattcaaattatctcgcctcttaataagggggacttaggaataaaaaaaataaat
aatagtatccaagaaaaatttaataaaaataaagccaaaaaattaaatgcaaaggattac
tcattttatgaagatgataaagtaatgtatctaaaaaatcaaggcgatttatctaatggc
gatattggagttattaaaagtataagtataggagagtctaaaagtaaaataaatgcattc
tttaacaaaaaggaaattcagttaaataatgccgatcttagtaatttagctttatgttat
gcttgcacagttcataagactcaaggtagcgaatttcaaaaagtaatcttagtgttagat
ccagaaataagtggctcctttattaataaaaagttggtttatacagctataactagggct
aaaaaagaactagttattattgccggcgaacaatcttttattaaaagtattaatcaaaga
ccagctaaaagagatacgacattaactgaagctataagactaatgtatagaaaaaaagaa
aaataa

DBGET integrated database retrieval system