KEGG   Mycoplasma bovis Hubei-1: MMB_0241Help
Entry
MMB_0241          CDS       T01568                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mbh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287539..288135
Genome map
AA seq 198 aa AA seqDB search
MILYRIGEIIHKHNSNIIFESQGIGYSLILPDPERVDVKQKCKLYLFEIKNEYQYATYAF
KDFKERLLFVDLISLNGIGPKAAFNILNFGFEKVSALIAEGNVEALIEIPYLNPRMARLI
VAELQAKWSKMISPKEAAKISVSTNTISEAKETLKMLGFKTKQIDNALAKVSTTDDIEKM
IEEAIKLISTQNYEPATA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattttatatagaataggtgaaataattcataaacataactcaaacataatatttgaa
agtcaagggataggttattcattgatactgccagatccagaaagggttgatgttaagcaa
aaatgcaagttgtatttatttgaaataaaaaatgaatatcagtatgcaacatatgctttt
aaagattttaaagaaagactactatttgttgatttaatatctcttaatggcattggacca
aaagcagcattcaatatattaaattttggatttgaaaaagtatcagcattaatagcagaa
ggcaatgttgaagcactcattgaaattccatatcttaaccctagaatggcaaggctgatt
gtggctgaattacaggctaaatggtcaaaaatgattagtcctaaagaagctgcaaaaata
agtgtatcaaccaacacaatatctgaagctaaagaaacacttaagatgctaggttttaaa
actaagcaaattgataatgcattagcaaaggtgtcaacaactgatgatattgaaaaaatg
attgaagaagcaattaaattaatttctactcaaaactatgaaccagctactgcttag

DBGET integrated database retrieval system