KEGG   Mycoplasma bovis Hubei-1: MMB_0315Help
Entry
MMB_0315          CDS       T01568                                 

Gene name
adhT1
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
mbh00010  Glycolysis / Gluconeogenesis
mbh00625  Chloroalkane and chloroalkene degradation
mbh00626  Naphthalene degradation
mbh01100  Metabolic pathways
mbh01110  Biosynthesis of secondary metabolites
mbh01120  Microbial metabolism in diverse environments
mbh01130  Biosynthesis of antibiotics
mbh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMB_0315 (adhT1)
  Lipid metabolism
   00071 Fatty acid degradation
    MMB_0315 (adhT1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MMB_0315 (adhT1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MMB_0315 (adhT1)
   00626 Naphthalene degradation
    MMB_0315 (adhT1)
Enzymes [BR:mbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MMB_0315 (adhT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C TrkA_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AEI90029
Position
382815..383876
Genome map
AA seq 353 aa AA seqDB search
MKQIPAKMKAFVVTEPKKWSVKEVDVPKPKYKEVLIEMETSGICHTDLHAANYDWLVEPK
YPLIPGHEGIGKVVALGEGCTRLKIGDRVALAWLHDACGYCEFCLTGRETLCPNQNMSAY
TKDGSYAEYAIGHEDYVGLVPEKLDIVTGAPIVCAGVTTYKSLKQTKAKAGNFVAVIGVG
GLGQMAIQYAKAMGLRPIGVDLQDEKCELALKSGAEYAFNSAKDPKFIEKIIEVTGGGVH
AVVNTSVHPSAAEQGMDMLRRGGRQVLVGLPAKDKHGKDDFKVSIFWSVLLERELAGSIV
GTRQDLAEALEYAAEGKVKSEVTKVVKLEEVADIFEKLQKGEFLGRAVIDFRK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattccagcaaaaatgaaagcttttgttgtaacagaacctaaaaaatgaagt
gttaaggaagttgatgttcctaaaccaaaatataaagaagttttaattgaaatggaaact
tcaggtatctgtcatacagacttgcatgcagcaaattatgactgattagtagaacctaaa
tacccacttattccaggccatgaaggaattggaaaggtagttgcattaggggaaggatgc
acacgtttgaaaattggtgatagagttgctttagcatgattacatgatgcttgtggctac
tgtgaattttgtctaacaggtagagaaacactttgtccaaatcaaaatatgtcggcttac
actaaagatggatcatatgctgaatatgcaattggtcatgaagattatgtaggattggtt
cctgaaaaattagatattgtaactggtgcgccaattgtttgcgcaggtgttacaacttat
aaatcattaaaacaaaccaaagcaaaagctggtaactttgtagctgttatcggtgtcggt
ggcttaggtcaaatggctattcaatatgcaaaagctatgggactaagacctattggtgtt
gacttgcaagatgaaaaatgtgaattagctcttaaatcaggcgcagaatatgcatttaac
tcagcaaaagatcctaaatttattgaaaaaattattgaagtaactggcggaggtgtacat
gctgtagttaatacatctgttcacccaagtgctgctgaacaaggtatggatatgcttcgt
cgcggcggccgtcaagtattagttggtttaccagcaaaagataaacacggaaaagatgac
tttaaagtctcaattttctggtcagtattattagaacgtgagcttgctggctcaattgtt
ggaactagacaagacctagcagaagctttagaatatgctgctgaaggaaaagttaaatca
gaagttactaaggttgtcaaattagaagaagttgcagatatttttgaaaaacttcaaaaa
ggcgagttcttaggacgtgctgttattgactttagaaaataa

DBGET integrated database retrieval system