KEGG   Mycoplasma bovis Hubei-1: MMB_0493Help
Entry
MMB_0493          CDS       T01568                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MMB_0493 (gtaB)
   00052 Galactose metabolism
    MMB_0493 (gtaB)
   00500 Starch and sucrose metabolism
    MMB_0493 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MMB_0493 (gtaB)
Enzymes [BR:mbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MMB_0493 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
599168..600055
Genome map
AA seq 295 aa AA seqDB search
MNKKVRKLIIPAAGWGTRFLPMTKVVHKELLPILDTPLISLLVDEAIEAGIEEIILIISE
RKKDIANYFAVNKELETELESKNKLSLLKKVKSTNKEGLIKIVIQHSQNGLGHALACAKN
VIKDEPFAIILGDDLIKSKVPAIKQLIEFYYKTGSNILGVQSVSDSDIPKYGIVAPIDEN
EKSTNFFKIKGAVEKPKLSEAPSNKAILGRYVFNSEILDILSKIEYDGSNEIQVVDAFEK
LQNEYKQDIYAFVFEGTRYDLGSVKGFVQANIDYALDNIELKDELTEFINEKLSE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagttagaaaattaattattccagctgctgggtgaggcactagatttttg
cctatgacaaaagttgtgcacaaagaacttttgcctattttggatacaccattaattagt
ttgcttgttgacgaagctatagaagcaggcatcgaagaaataattcttattattagcgaa
agaaaaaaagatattgcaaactattttgctgttaataaagaattagaaactgaattagaa
tcaaaaaataagttatcactattaaaaaaggtgaaatcaacaaataaggaaggtctgatt
aaaattgttatccagcatagtcaaaatggtttaggacatgccttagcatgtgcaaaaaac
gttattaaagatgagccatttgcaattattttaggagatgatttaataaaatctaaagtt
cctgcaattaaacaattgattgaattttactataaaacaggttcaaacatcttgggagtt
caatcagtaagcgatagcgatatacccaaatatggaattgttgcgcctatagatgaaaat
gaaaagagtacaaactttttcaaaattaaaggtgctgtagaaaaaccaaaattaagtgaa
gcaccaagcaataaagcaatcttaggaagatatgtattcaatagtgaaatattagacata
cttagcaaaattgaatatgatggatctaatgaaattcaagttgttgatgcatttgaaaaa
ttgcaaaatgaatataaacaagatatctatgcatttgtatttgaaggaacaagatatgac
ttaggctcagtcaaaggatttgttcaagctaatattgactatgcattggataatatagag
cttaaggatgaattaacagaatttataaacgaaaagctaagtgaataa

DBGET integrated database retrieval system