KEGG   Mycoplasma bovis Hubei-1: MMB_0553Help
Entry
MMB_0553          CDS       T01568                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mbh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbh00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mbh00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(670719..671501)
Genome map
AA seq 260 aa AA seqDB search
MKQFIVIGNWKMYKTFTETLNFFDEFAIEYKKFRKANSELVPYIDNNIFGVAPSQCNLPA
YFTNKIPELKLCSQNMSKNEEGAFTGEVSARMLRDINVSYALCGHSERRRYHSNHENDES
THLKIKQSVKYDITPIICIGESKEDRDAGRTEEAIHKQLQILLDEVNIHKVIIAYEPVWS
IGTGITPTPEEVENVSALIHKLTSPEVPVLYGGSISEKNINDFTNLPNLNGFLVGSASLK
IDKFLKLISANSDGIMPKEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttatagtcattggcaattgaaaaatgtataaaacatttacagaaacatta
aacttttttgatgagtttgctatagaatacaaaaagtttcgcaaagctaattctgaatta
gttccttacattgataataacatttttggcgtagctccttcacaatgtaatttgcctgct
tattttacaaataagattcctgaacttaaattatgcagtcaaaatatgtctaaaaatgaa
gaaggcgcttttactggagaagtaagcgcaagaatgcttagagatatcaatgtttcatat
gctttatgtgggcattcagaaagaagaagatatcacagcaaccatgaaaatgatgaatca
actcatttaaaaataaagcagtcagttaaatatgacataacaccaattatctgcattgga
gaatctaaagaagacagagatgctggcagaactgaagaggctattcataaacagttacaa
atccttttagatgaagttaatattcacaaagttattatagcttatgaaccagtatgatca
ataggaactggaataactcctacacctgaagaagttgaaaatgtcagtgcactaattcat
aagctaactagccctgaagtgcctgttttatatggtggcagcattagcgagaaaaatata
aatgattttaccaatttgcctaatttaaacggttttttggttggctcagcaagtttaaaa
attgacaaatttttaaaacttatatcagcaaattctgacggaattatgcctaaagaaaaa
taa

DBGET integrated database retrieval system