KEGG   Mycoplasma bovis Hubei-1: MMB_0553Help
Entry
MMB_0553          CDS       T01568                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
mbh00010  Glycolysis / Gluconeogenesis
mbh00051  Fructose and mannose metabolism
mbh01100  Metabolic pathways
mbh01110  Biosynthesis of secondary metabolites
mbh01120  Microbial metabolism in diverse environments
mbh01130  Biosynthesis of antibiotics
mbh01200  Carbon metabolism
mbh01230  Biosynthesis of amino acids
Module
mbh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMB_0553 (tpiA)
   00051 Fructose and mannose metabolism
    MMB_0553 (tpiA)
   00562 Inositol phosphate metabolism
    MMB_0553 (tpiA)
Enzymes [BR:mbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MMB_0553 (tpiA)
Exosome [BR:mbh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MMB_0553 (tpiA)
  Exosomal proteins of bladder cancer cells
   MMB_0553 (tpiA)
  Exosomal proteins of melanoma cells
   MMB_0553 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM FtsZ_C
Motif
Other DBs
NCBI-ProteinID: AEI90267
Position
complement(670719..671501)
Genome map
AA seq 260 aa AA seqDB search
MKQFIVIGNWKMYKTFTETLNFFDEFAIEYKKFRKANSELVPYIDNNIFGVAPSQCNLPA
YFTNKIPELKLCSQNMSKNEEGAFTGEVSARMLRDINVSYALCGHSERRRYHSNHENDES
THLKIKQSVKYDITPIICIGESKEDRDAGRTEEAIHKQLQILLDEVNIHKVIIAYEPVWS
IGTGITPTPEEVENVSALIHKLTSPEVPVLYGGSISEKNINDFTNLPNLNGFLVGSASLK
IDKFLKLISANSDGIMPKEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttatagtcattggcaattgaaaaatgtataaaacatttacagaaacatta
aacttttttgatgagtttgctatagaatacaaaaagtttcgcaaagctaattctgaatta
gttccttacattgataataacatttttggcgtagctccttcacaatgtaatttgcctgct
tattttacaaataagattcctgaacttaaattatgcagtcaaaatatgtctaaaaatgaa
gaaggcgcttttactggagaagtaagcgcaagaatgcttagagatatcaatgtttcatat
gctttatgtgggcattcagaaagaagaagatatcacagcaaccatgaaaatgatgaatca
actcatttaaaaataaagcagtcagttaaatatgacataacaccaattatctgcattgga
gaatctaaagaagacagagatgctggcagaactgaagaggctattcataaacagttacaa
atccttttagatgaagttaatattcacaaagttattatagcttatgaaccagtatgatca
ataggaactggaataactcctacacctgaagaagttgaaaatgtcagtgcactaattcat
aagctaactagccctgaagtgcctgttttatatggtggcagcattagcgagaaaaatata
aatgattttaccaatttgcctaatttaaacggttttttggttggctcagcaagtttaaaa
attgacaaatttttaaaacttatatcagcaaattctgacggaattatgcctaaagaaaaa
taa

DBGET integrated database retrieval system