KEGG   Mycoplasma bovis HB0801: Mbov_0105Help
Entry
Mbov_0105         CDS       T02143                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mbi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mbi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mbi00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
114232..114966
Genome map
AA seq 244 aa AA seqDB search
MAVELAKVKPLEEKEAPISGIRKAIAKNLKEVLETSAYCSLVLKADVTNLWNLRAKVKDK
VFEEHNIKLTFLSWIVKASAIALSEYPSFAARWDGVEGKVYYPGTLNIAIAVDTPFGLFV
PVIRGVENLSIIEIQKEIVRLSTLAREKKLKMSDMTGGCFAITNVGSAGVLFGSPIMNKG
NTAISATGAIIDELKLNKEGAVENRKVMYLSIAADHQWVDGADMARFQGRIKELIENPEQ
LGEF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgagctcgcaaaagttaaaccactagaagaaaaagaagctcctatttcagga
attcgtaaagctattgctaaaaacttaaaagaagttttagaaacatctgcatattgttca
ttagttttaaaagctgatgttacaaatctttgaaacttacgtgcaaaagttaaagacaaa
gtttttgaagaacacaatattaaattaacattcctatcatgaatagttaaagcctcggct
attgctttaagcgaatacccatcttttgctgctagatgagatggtgttgaaggtaaagta
tactaccctggaacacttaacattgctatagctgttgacacacctttcggtctatttgta
cctgtaattagaggtgttgaaaacctaagtataattgaaattcaaaaagaaattgttaga
ttatcaacacttgcaagagaaaagaagctaaaaatgtcagatatgacaggtggctgcttt
gctattacaaacgttggtagtgccggtgtattattcggttctccaattatgaacaaaggc
aatacagcaatttcagctactggtgcaatcattgatgagttaaaattaaacaaagaaggt
gctgttgaaaacagaaaagtaatgtacttatcaatagcagctgaccaccaatgagttgat
ggtgctgatatggctcgtttccaaggcagaattaaagaattaatcgaaaatccagaacaa
ttaggagaattttaa

DBGET integrated database retrieval system