KEGG   Mycoplasma bovis HB0801: Mbov_0105Help
Entry
Mbov_0105         CDS       T02143                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
mbi00010  Glycolysis / Gluconeogenesis
mbi00020  Citrate cycle (TCA cycle)
mbi00620  Pyruvate metabolism
mbi01100  Metabolic pathways
mbi01110  Biosynthesis of secondary metabolites
mbi01120  Microbial metabolism in diverse environments
mbi01130  Biosynthesis of antibiotics
mbi01200  Carbon metabolism
Module
mbi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbov_0105
   00020 Citrate cycle (TCA cycle)
    Mbov_0105
   00620 Pyruvate metabolism
    Mbov_0105
Enzymes [BR:mbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mbov_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Trans_coact
Motif
Other DBs
NCBI-ProteinID: AFM51480
Position
114232..114966
Genome map
AA seq 244 aa AA seqDB search
MAVELAKVKPLEEKEAPISGIRKAIAKNLKEVLETSAYCSLVLKADVTNLWNLRAKVKDK
VFEEHNIKLTFLSWIVKASAIALSEYPSFAARWDGVEGKVYYPGTLNIAIAVDTPFGLFV
PVIRGVENLSIIEIQKEIVRLSTLAREKKLKMSDMTGGCFAITNVGSAGVLFGSPIMNKG
NTAISATGAIIDELKLNKEGAVENRKVMYLSIAADHQWVDGADMARFQGRIKELIENPEQ
LGEF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgagctcgcaaaagttaaaccactagaagaaaaagaagctcctatttcagga
attcgtaaagctattgctaaaaacttaaaagaagttttagaaacatctgcatattgttca
ttagttttaaaagctgatgttacaaatctttgaaacttacgtgcaaaagttaaagacaaa
gtttttgaagaacacaatattaaattaacattcctatcatgaatagttaaagcctcggct
attgctttaagcgaatacccatcttttgctgctagatgagatggtgttgaaggtaaagta
tactaccctggaacacttaacattgctatagctgttgacacacctttcggtctatttgta
cctgtaattagaggtgttgaaaacctaagtataattgaaattcaaaaagaaattgttaga
ttatcaacacttgcaagagaaaagaagctaaaaatgtcagatatgacaggtggctgcttt
gctattacaaacgttggtagtgccggtgtattattcggttctccaattatgaacaaaggc
aatacagcaatttcagctactggtgcaatcattgatgagttaaaattaaacaaagaaggt
gctgttgaaaacagaaaagtaatgtacttatcaatagcagctgaccaccaatgagttgat
ggtgctgatatggctcgtttccaaggcagaattaaagaattaatcgaaaatccagaacaa
ttaggagaattttaa

DBGET integrated database retrieval system