KEGG   Mycoplasma bovis HB0801: Mbov_0105Help
Entry
Mbov_0105         CDS       T02143                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbov_0105
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbov_0105
   00020 Citrate cycle (TCA cycle)
    Mbov_0105
   00620 Pyruvate metabolism
    Mbov_0105
Enzymes [BR:mbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mbov_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
114232..114966
Genome map
AA seq 244 aa AA seqDB search
MAVELAKVKPLEEKEAPISGIRKAIAKNLKEVLETSAYCSLVLKADVTNLWNLRAKVKDK
VFEEHNIKLTFLSWIVKASAIALSEYPSFAARWDGVEGKVYYPGTLNIAIAVDTPFGLFV
PVIRGVENLSIIEIQKEIVRLSTLAREKKLKMSDMTGGCFAITNVGSAGVLFGSPIMNKG
NTAISATGAIIDELKLNKEGAVENRKVMYLSIAADHQWVDGADMARFQGRIKELIENPEQ
LGEF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgagctcgcaaaagttaaaccactagaagaaaaagaagctcctatttcagga
attcgtaaagctattgctaaaaacttaaaagaagttttagaaacatctgcatattgttca
ttagttttaaaagctgatgttacaaatctttgaaacttacgtgcaaaagttaaagacaaa
gtttttgaagaacacaatattaaattaacattcctatcatgaatagttaaagcctcggct
attgctttaagcgaatacccatcttttgctgctagatgagatggtgttgaaggtaaagta
tactaccctggaacacttaacattgctatagctgttgacacacctttcggtctatttgta
cctgtaattagaggtgttgaaaacctaagtataattgaaattcaaaaagaaattgttaga
ttatcaacacttgcaagagaaaagaagctaaaaatgtcagatatgacaggtggctgcttt
gctattacaaacgttggtagtgccggtgtattattcggttctccaattatgaacaaaggc
aatacagcaatttcagctactggtgcaatcattgatgagttaaaattaaacaaagaaggt
gctgttgaaaacagaaaagtaatgtacttatcaatagcagctgaccaccaatgagttgat
ggtgctgatatggctcgtttccaaggcagaattaaagaattaatcgaaaatccagaacaa
ttaggagaattttaa

DBGET integrated database retrieval system