KEGG   Mycoplasma bovis HB0801: Mbov_0231Help
Entry
Mbov_0231         CDS       T02143                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mbi00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
262358..262945
Genome map
AA seq 195 aa AA seqDB search
MIKSTNKKPIIIFAGPSGVGKGTIEKYLFEDKELRLHLACSATTRSPRAGEIDGIHYFFI
TKNDFENKIAENAFLEYSYHFENYYGTLYAEIDRIHELNKVPFLEIETNGAKQILSKKDV
NDRYKVITFFILPPSVEELKNRILNRNTENNDAINIRMQKAIDEINDQHLFKHKIVNDDA
ELAAKKVTQIIKEEI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaagcactaacaagaagccaatcatcatttttgcagggccaagtggcgttgga
aaaggaacaattgaaaaatatttatttgaagataaagagctaaggctacacttagcttgt
tctgccacaacaagaagtcctagagctggtgaaattgatggtattcactatttctttatc
actaaaaatgattttgaaaacaaaattgctgaaaatgcattcttagaatatagttatcac
ttcgaaaactattatggcaccttgtatgctgaaattgatcgaattcatgaattaaataaa
gttccatttttagaaattgaaactaatggtgcaaaacaaatcttgagcaaaaaagacgtt
aatgacagatataaagttattacattttttattcttccaccatctgttgaggaacttaaa
aacagaatcttaaacagaaatactgagaataacgatgctataaatattagaatgcaaaaa
gcaatagatgagattaatgatcagcatttatttaaacataaaattgttaatgatgatgct
gagttagctgccaaaaaagtaactcagataataaaggaagaaatataa

DBGET integrated database retrieval system