KEGG   Mycoplasma bovis HB0801: Mbov_0238Help
Entry
Mbov_0238         CDS       T02143                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mbi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mbov_0238 (recD)
Enzymes [BR:mbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mbov_0238 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(268717..270942)
Genome map
AA seq 741 aa AA seqDB search
MEMKSFIGYIKEFTNNSDENWPVANFYILKTRKTIKISGNISRMLDKSLYKIEVSEIDDN
SESANNIKTYKCNFYQSLTVIDNQTFFEYLKSDAFNKVADDDFINILKSYYESDDILKEI
LANKEKFLAIKRVQKCILESIFNKLNITALQIEFNVNGLDLDVLVKLTELYNGSFDQIIK
AIKNDLFEINFQHEITNLESIDKIFLHFNNDANNVVRIAYYLHYYCNQILNNKSSTYTSL
ENVKKCFYDENKFFIPAEQKEQIVNDAIKYALNKELLLIKENKVYTTQTYNDEMTIASFL
AKKSRVKKIGSYKFKKYIREIQKETNIENFKYDKSQINALRKFINNKFVVITGGPGTGKT
TLIKGLVKLFKKVHPNESFKIATPTGRAAARIKESFKESNAVTIHKLLQYDDSTGKFRKN
VFNPLDDGLLIIDETSMVDNNLFSHFISAIGEAKRVVFVGDIEQLPSIGIGNAFEDIIKS
KKITTVELKSTHRQKVQSKITELAYMIRNNNFNITKLQETTENSDLKTIFVDNQKQCLNE
IIKNYHINDSDKAGNDSDISYNIQIISPLNKGDLGIKKINNSIQEKFNKNKAKKLNAKDY
SFYEDDKVMYLKNQGDLSNGDIGVIKSISIGESKSKINAFFNKKEIQLNNADLSNLALCY
ACTVHKTQGSEFQKVILVLDPEISGSFINKKLVYTAITRAKKELVIIAGEQSFIKSINQR
PAKRDTTLTEAIRLMYRKKEK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaaatcatttataggttatataaaagaatttactaataattcagatgaaaac
tgacctgttgctaatttttatattttaaagacaaggaaaactattaaaattagtggaaat
atcagcagaatgctagataagagtttatataaaattgaagtaagtgaaattgatgacaat
tcagaatcagcaaataatattaagacttataaatgtaatttttatcaatcattaactgtt
attgacaatcaaactttttttgaatatttgaaatctgatgcatttaataaagttgctgat
gatgattttattaatatattaaaatcatattatgaatcagatgatatcttaaaagaaata
cttgcaaataaagaaaaatttctagccattaagcgtgtacaaaagtgtattttagaaagc
atttttaataaacttaacattactgctttgcaaatagaatttaatgttaatggccttgat
ttagatgtactagttaaattaacagaactatataatggctcgtttgatcaaataataaaa
gcaattaagaatgatttatttgaaattaattttcaacatgaaataactaatttagaatct
atagataaaatctttttgcactttaataatgatgcaaataatgttgtaagaattgcttat
tatttgcattattattgcaaccaaattctaaataataaatctagtacttatacaagttta
gaaaatgtaaaaaaatgtttttatgatgaaaacaagttttttattcccgcagagcaaaaa
gaacaaattgttaatgatgcaataaagtatgctttaaataaagaactgcttttaattaaa
gaaaacaaagtttatacaactcaaacatataatgatgaaatgactattgcttcattttta
gctaaaaaaagcagagttaaaaaaattggttcttataaatttaaaaaatatatacgagaa
attcaaaaagaaacaaacatagaaaactttaaatatgataaaagccaaattaatgcatta
aggaaatttattaataataagtttgtagtaatcaccggtgggcctggaactggcaaaact
actttaataaaaggtttagtaaaactatttaaaaaagttcacccaaatgaaagttttaaa
atagcaacgccaacaggaagagcagccgcaagaattaaagagagttttaaagaatctaat
gctgtaactattcataaattgttgcaatatgatgattcaaccggtaaatttagaaaaaat
gtattcaatcctttggatgatggtttattaattattgatgaaacttcaatggttgataat
aatttatttagtcactttatttcagctattggagaggcaaaaagagtagtttttgttggt
gacatagagcaattaccaagtattggaattggcaatgcatttgaagatattattaaatct
aaaaaaataacaactgttgaattaaaaagcacacaccgtcaaaaagttcaaagtaagatt
actgaattagcttatatgattagaaataataatttcaatattacaaaacttcaagaaaca
acagaaaatagcgatttaaaaactatttttgttgataatcaaaaacaatgcttaaatgaa
attattaaaaattatcatattaatgatagtgataaagccggtaatgattctgatatttca
tataatattcaaattatctcgcctcttaataagggggacttaggaataaaaaaaataaat
aatagtatccaagaaaaatttaataaaaataaagccaaaaaattaaatgcaaaggattac
tcattttatgaagatgataaagtaatgtatctaaaaaatcaaggcgatttatctaatggc
gatattggagttattaaaagtataagtataggagagtctaaaagtaaaataaatgcattc
tttaacaaaaaggaaattcagttaaataatgccgatcttagtaatttagctttatgttat
gcttgcacagttcataagactcaaggtagcgaatttcaaaaagtaatcttagtgttagat
ccagaaataagtggctcctttattaataaaaagttggtttatacagctataactagggct
aaaaaagaactagttattattgccggcgaacaatcttttattaaaagtattaatcaaaga
ccagctaaaagagatacgacattaactgaagctataagactaatgtatagaaaaaaagaa
aaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system