KEGG   Mycoplasma bovis HB0801: Mbov_0325Help
Entry
Mbov_0325         CDS       T02143                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mbov_0325 (glpK)
Enzymes [BR:mbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mbov_0325 (glpK)
Exosome [BR:mbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mbov_0325 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(383525..385033)
Genome map
AA seq 502 aa AA seqDB search
MEKYILTLDEGTTSARTLIVNKKGEIIAVEQAEFTQHFPKEGWVEHDAIEIWNTQRSTLV
QVLNKSKISPEQIDSIGITNQRETVVIWNKETGLPIYNAIVWQDQRTAEYCQSFNKEQLE
LVKEKTGLIINPYFSGTKVKWILDNVPNARELAAEGKLMFGTINTWLIYRLTGGKVFATD
HTNAQRTLLYNIHTNDWDNDLLELFNIPRSILPEIKSCSEDYGVTFPHLFSRDNASEIRI
TSSIGDQQSALFGQLCLEKGQSKITYGTGCFILTNTGSQIVKSNHGLLTTIAYSFKDKIL
YALEGSVMIAGAAVQWLRDNLKIVYSALETEWYAGQVNDDRRVYVVPSFTGLGSPYWDSY
SRGAIFGLDRGTKREHIVRATLEAIAYQANDVVSAMGKDMNDPIKIFKVDGGASNNKFMM
QFQSNISQSKVIKPVNIETTAMGAAFMAGLATGYWKSIDEIKDTYKVHFEITPEISATEA
NKLVKGWNVAVKRTFNWTKDIE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatacatattaactttagatgaaggtacaacaagtgctagaacattaatagtt
aataaaaaaggcgaaattattgctgttgaacaagcagaatttacacagcactttccaaaa
gaaggctgagttgaacacgatgcaattgaaatttggaacactcaacgttcaacattagtt
caggtgctcaataaatcaaaaattagtcctgagcaaattgattctattggtataacaaat
caaagagaaactgttgttatttgaaataaagaaacaggattgcctatttataatgcaatt
gtttggcaagatcaaagaacagctgaatattgtcaatcatttaacaaagagcaacttgaa
ttagtaaaagagaaaactggattaatcattaatccctatttctcaggtacaaaagtaaaa
tgaatactagacaatgtgcctaatgcaagagaattagctgctgaaggcaaactaatgttt
ggaactataaatacatgacttatttataggcttactggtggaaaagtgtttgcaactgac
cataccaatgcacaaagaacacttttatacaatattcacactaatgactgggataatgat
ctactagaattatttaatattcctagaagcatacttccagaaattaagtcttgtagtgaa
gattatggagttacattcccacatttattttctagagataatgcaagcgaaattagaata
acatcatcaattggtgaccaacaaagcgctctttttggccagttatgtttagaaaagggt
caatcaaaaattacatatggaactggttgcttcattctaacaaacactggaagccaaatt
gttaagtcaaatcatggtcttttaacaacaattgcatattcattcaaagacaaaatacta
tatgcattagaaggatctgtaatgatagccggtgcggctgtacaatgactaagggataac
ttaaaaattgtatatagtgccttagaaactgaatgatatgctggacaagttaatgatgac
agaagagtttatgtagtgccctcatttactggcttaggttctccatattgagactcatat
tcacgtggtgctatatttggtttggatagaggcacaaaaagagaacatattgttagggca
acactagaagctattgcttaccaggctaatgatgttgtaagcgctatgggtaaggatatg
aatgatcctattaaaatatttaaggttgatggtggagcatcaaataataaatttatgatg
caatttcagtcaaatatttctcaatcaaaagttattaaaccagtaaacatcgaaacaact
gcaatgggagctgcctttatggctggcttagctactggatactgaaagagcattgatgaa
ataaaagacacatacaaagttcactttgaaataacccctgagatttctgctaccgaagca
aataaattagttaaaggttgaaatgttgctgtaaaaagaacattcaactgaacaaaggac
atcgaatag

DBGET integrated database retrieval system