KEGG   Mycoplasma bovis HB0801: Mbov_0338Help
Entry
Mbov_0338         CDS       T02143                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mbov_0338 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbov_0338 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Mbov_0338 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mbov_0338 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mbov_0338 (adh)
   00626 Naphthalene degradation
    Mbov_0338 (adh)
Enzymes [BR:mbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mbov_0338 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399768..400829
Genome map
AA seq 353 aa AA seqDB search
MKQIPAKMKAFVVTEPKKWSVKEVDVPKPKYKEVLIEMETSGICHTDLHAANYDWLVEPK
YPLIPGHEGIGKVVALGEGCTRLKIGDRVALAWLHDACGYCEFCLTGRETLCPNQNMSAY
TKDGSYAEYAIGHEDYVGLVPEKLDIVTGAPIVCAGVTTYKSLKQTKAKAGNFVAVIGVG
GLGQMAIQYAKAMGLRPIGVDLQDEKCELALKSGAEYAFNSAKDPKFIEKIIEVTGGGVH
AVVNTSVHPSAAEQGMDMLRRGGRQVLVGLPAKDKHGKDDFKVSIFWSVLLERELAGSIV
GTRQDLAEALEYAAEGKVKSEVTKVVKLEEVADIFEKLQKGEFLGRAVIDFRK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattccagcaaaaatgaaagcttttgttgtaacagaacctaaaaaatgaagt
gttaaggaagttgatgttcctaaaccaaaatataaagaagttttaattgaaatggaaact
tcaggtatctgtcatacagacttgcatgcagcaaattatgactgattagtagaacctaaa
tacccacttattccaggccatgaaggaattggaaaggtagttgcattaggggaaggatgc
acacgtttgaaaattggtgatagagttgctttagcatgattacatgatgcttgtggctac
tgtgaattttgtctaacaggtagagaaacactttgtccaaatcaaaatatgtcggcttac
actaaagatggatcatatgctgaatatgcaattggtcatgaagattatgtaggattggtt
cctgaaaaattagatattgtaactggtgcgccaattgtttgcgcaggtgttacaacttat
aaatcattaaaacaaaccaaagcaaaagctggtaactttgtagctgttatcggtgtcggt
ggcttaggtcaaatggctattcaatatgcaaaagctatgggactaagacctattggtgtt
gacttgcaagatgaaaaatgtgaattagctcttaaatcaggcgcagaatatgcatttaac
tcagcaaaagatcctaaatttattgaaaaaattattgaagtaactggcggaggtgtacat
gctgtagttaatacatctgttcacccaagtgctgctgaacaaggtatggatatgcttcgt
cgcggcggccgtcaagtattagttggtttaccagcaaaagataaacacggaaaagatgac
tttaaagtctcaattttctggtcagtattattagaacgtgagcttgctggctcaattgtt
ggaactagacaagacctagcagaagctttagaatatgctgctgaaggaaaagttaaatca
gaagttactaaggttgtcaaattagaagaagttgcagatatttttgaaaaacttcaaaaa
ggcgagttcttaggacgtgctgttattgactttagaaaataa

DBGET integrated database retrieval system