KEGG   Mycoplasma bovis HB0801: Mbov_0338Help
Entry
Mbov_0338         CDS       T02143                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
mbi00010  Glycolysis / Gluconeogenesis
mbi00625  Chloroalkane and chloroalkene degradation
mbi00626  Naphthalene degradation
mbi01100  Metabolic pathways
mbi01110  Biosynthesis of secondary metabolites
mbi01120  Microbial metabolism in diverse environments
mbi01130  Biosynthesis of antibiotics
mbi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbov_0338 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Mbov_0338 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mbov_0338 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mbov_0338 (adh)
   00626 Naphthalene degradation
    Mbov_0338 (adh)
Enzymes [BR:mbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mbov_0338 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C TrkA_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFM51706
Position
399768..400829
Genome map
AA seq 353 aa AA seqDB search
MKQIPAKMKAFVVTEPKKWSVKEVDVPKPKYKEVLIEMETSGICHTDLHAANYDWLVEPK
YPLIPGHEGIGKVVALGEGCTRLKIGDRVALAWLHDACGYCEFCLTGRETLCPNQNMSAY
TKDGSYAEYAIGHEDYVGLVPEKLDIVTGAPIVCAGVTTYKSLKQTKAKAGNFVAVIGVG
GLGQMAIQYAKAMGLRPIGVDLQDEKCELALKSGAEYAFNSAKDPKFIEKIIEVTGGGVH
AVVNTSVHPSAAEQGMDMLRRGGRQVLVGLPAKDKHGKDDFKVSIFWSVLLERELAGSIV
GTRQDLAEALEYAAEGKVKSEVTKVVKLEEVADIFEKLQKGEFLGRAVIDFRK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattccagcaaaaatgaaagcttttgttgtaacagaacctaaaaaatgaagt
gttaaggaagttgatgttcctaaaccaaaatataaagaagttttaattgaaatggaaact
tcaggtatctgtcatacagacttgcatgcagcaaattatgactgattagtagaacctaaa
tacccacttattccaggccatgaaggaattggaaaggtagttgcattaggggaaggatgc
acacgtttgaaaattggtgatagagttgctttagcatgattacatgatgcttgtggctac
tgtgaattttgtctaacaggtagagaaacactttgtccaaatcaaaatatgtcggcttac
actaaagatggatcatatgctgaatatgcaattggtcatgaagattatgtaggattggtt
cctgaaaaattagatattgtaactggtgcgccaattgtttgcgcaggtgttacaacttat
aaatcattaaaacaaaccaaagcaaaagctggtaactttgtagctgttatcggtgtcggt
ggcttaggtcaaatggctattcaatatgcaaaagctatgggactaagacctattggtgtt
gacttgcaagatgaaaaatgtgaattagctcttaaatcaggcgcagaatatgcatttaac
tcagcaaaagatcctaaatttattgaaaaaattattgaagtaactggcggaggtgtacat
gctgtagttaatacatctgttcacccaagtgctgctgaacaaggtatggatatgcttcgt
cgcggcggccgtcaagtattagttggtttaccagcaaaagataaacacggaaaagatgac
tttaaagtctcaattttctggtcagtattattagaacgtgagcttgctggctcaattgtt
ggaactagacaagacctagcagaagctttagaatatgctgctgaaggaaaagttaaatca
gaagttactaaggttgtcaaattagaagaagttgcagatatttttgaaaaacttcaaaaa
ggcgagttcttaggacgtgctgttattgactttagaaaataa

DBGET integrated database retrieval system