KEGG   Mycoplasma bovis HB0801: Mbov_0486Help
Entry
Mbov_0486         CDS       T02143                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mbi03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
567362..568201
Genome map
AA seq 279 aa AA seqDB search
MPELPEVKTVVKALKSNIKNAKITDVFVFLDKLIKNVSPQEFKEYLLNETILDIYNVGKN
IIFKLSKDKNLISHLRMTGKYFTDTSLHHKRKHDYVIFELNNQMYLFYNDSRQFGTFHIK
DESELFTTKPLDKLGKEVDQIDPDKLYQLIKNKTIPIKSFLLDQSYILGIGNIYANEILY
LSGVNPWTKVNKIPYAKLIQILNNTKIILDKATELGGSTIVDFSGLNGAEGQFQNHLQVH
MRANLPCNKCKTLIKQETIAQRMTYYCPLCQKENYEQEK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgccagaagttaaaacagtagttaaagcacttaaaagcaacataaagaat
gccaaaattacggacgtttttgtgtttcttgataaattaattaaaaatgttagtccgcaa
gaatttaaagaatatttgctaaatgaaacaatattagatatttataatgttggcaaaaat
attatttttaagctttctaaagacaaaaatttaattagccatttaagaatgacaggcaag
tattttactgatactagtttgcatcacaagagaaaacatgattatgtaatttttgagtta
aataaccaaatgtatctgttttataatgattcacgacaatttggaacatttcatattaag
gatgaatcagaactttttacaacaaagccgcttgataaattaggaaaagaagttgatcaa
atagatcctgataaactttatcagcttattaaaaataaaactattccaattaagtcattc
ctgttagatcaaagttacattttaggaataggaaatatttacgctaacgaaattttgtat
ttgtctggagttaatccatgaaccaaggttaataaaattccatatgctaaattgattcaa
atattaaataacactaagataattttggataaggcaacagagttaggtggttcaacaatt
gttgacttttcaggtcttaatggagcagaaggccaatttcaaaatcatttacaagttcac
atgcgagcaaatttgccttgcaataaatgcaaaactttaataaaacaagaaacaatagca
caaagaatgacatattattgtccgctgtgtcagaaggaaaattatgagcaagaaaagtag

DBGET integrated database retrieval system