KEGG   Mycoplasma bovis HB0801: Mbov_0532Help
Entry
Mbov_0532         CDS       T02143                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mbov_0532 (galU)
   00052 Galactose metabolism
    Mbov_0532 (galU)
   00500 Starch and sucrose metabolism
    Mbov_0532 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Mbov_0532 (galU)
Enzymes [BR:mbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mbov_0532 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626897..627784
Genome map
AA seq 295 aa AA seqDB search
MNKKVRKLIIPAAGWGTRFLPMTKVVHKELLPILDTPLISLLVDEAIEAGIEEIILIISE
RKKDIANYFAVNKELETELESKNKLSLLKKVKSTNKEGLIKIVIQHSQNGLGHALACAKN
VIKDEPFAIILGDDLIKSKVPAIKQLIEFYYKTGSNILGVQSVSDSDIPKYGIVAPIDEN
EKSTNFFKIKGAVEKPKLSEAPSNKAILGRYVFNSEILDILSKIEYDGSNEIQVVDAFEK
LQNEYKQDIYAFVFEGTRYDLGSVKGFVQANIDYALDNIELKDELTEFINEKLSE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagttagaaaattaattattccagctgctgggtgaggcactagatttttg
cctatgacaaaagttgtgcacaaagaacttttgcctattttggatacaccattaattagt
ttgcttgttgacgaagctatagaagcaggcatcgaagaaataattcttattattagcgaa
agaaaaaaagatattgcaaactattttgctgttaataaagaattagaaactgaattagaa
tcaaaaaataagttatcactattaaaaaaggtgaaatcaacaaataaggaaggtctgatt
aaaattgttatccagcatagtcaaaatggtttaggacatgccttagcatgtgcaaaaaac
gttattaaagatgagccatttgcaattattttaggagatgatttaataaaatctaaagtt
cctgcaattaaacaattgattgaattttactataaaacaggttcaaacatcttgggagtt
caatcagtaagcgatagcgatatacccaaatatggaattgttgcgcctatagatgaaaat
gaaaagagtacaaactttttcaaaattaaaggtgctgtagaaaaaccaaaattaagtgaa
gcaccaagcaataaagcaatcttaggaagatatgtattcaatagtgaaatattagacata
cttagcaaaattgaatatgatggatctaatgaaattcaagttgttgatgcatttgaaaaa
ttgcaaaatgaatataaacaagatatctatgcatttgtatttgaaggaacaagatatgac
ttaggctcagtcaaaggatttgttcaagctaatattgactatgcattggataatatagag
cttaaggatgaattaacagaatttataaacgaaaagctaagtgaataa

DBGET integrated database retrieval system