KEGG   Mycoplasma bovis HB0801: Mbov_0591Help
Entry
Mbov_0591         CDS       T02143                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbi  Mycoplasma bovis HB0801
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbov_0591 (tpiA)
   01230 Biosynthesis of amino acids
    Mbov_0591 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbov_0591 (tpiA)
   00051 Fructose and mannose metabolism
    Mbov_0591 (tpiA)
   00562 Inositol phosphate metabolism
    Mbov_0591 (tpiA)
Enzymes [BR:mbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mbov_0591 (tpiA)
Exosome [BR:mbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mbov_0591 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mbov_0591 (tpiA)
  Exosomal proteins of melanoma cells
   Mbov_0591 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(698444..699226)
Genome map
AA seq 260 aa AA seqDB search
MKQFIVIGNWKMYKTFTETLNFFDEFAIEYKKFRKANSELVPYIDNNIFGVAPSQCNLPA
YFTNKIPELKLCSQNMSKNEEGAFTGEVSARMLRDINVSYALCGHSERRRYHSNHENDES
THLKIKQSVKYDITPIICIGESKEDRDAGRTEEAIHKQLQILLDEVNIHKVIIAYEPVWS
IGTGITPTPEEVENVSALIHKLTSPEVPVLYGGSISEKNINDFTNLPNLNGFLVGSASLK
IDKFLKLISANSDGIMPKEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttatagtcattggcaattgaaaaatgtataaaacatttacagaaacatta
aacttttttgatgagtttgctatagaatacaaaaagtttcgcaaagctaattctgaatta
gttccttacattgataataacatttttggcgtagctccttcacaatgtaatttgcctgct
tattttacaaataagattcctgaacttaaattatgcagtcaaaatatgtctaaaaatgaa
gaaggcgcttttactggagaagtaagcgcaagaatgcttagagatatcaatgtttcatat
gctttatgtgggcattcagaaagaagaagatatcacagcaaccatgaaaatgatgaatca
actcatttaaaaataaagcagtcagttaaatatgacataacaccaattatctgcattgga
gaatctaaagaagacagagatgctggcagaactgaagaggctattcataaacagttacaa
atccttttagatgaagttaatattcacaaagttattatagcttatgaaccagtatgatca
ataggaactggaataactcctacacctgaagaagttgaaaatgtcagtgcactaattcat
aagctaactagccctgaagtgcctgttttatatggtggcagcattagcgagaaaaatata
aatgattttaccaatttgcctaatttaaacggttttttggttggctcagcaagtttaaaa
attgacaaatttttaaaacttatatcagcaaattctgacggaattatgcctaaagaaaaa
taa

DBGET integrated database retrieval system