KEGG   Candidatus Izimaplasma sp. HR1: KQ51_01049Help
Entry
KQ51_01049        CDS       T03291                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbj  Candidatus Izimaplasma sp. HR1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mbj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KQ51_01049 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    KQ51_01049 (thlA)
   00640 Propanoate metabolism
    KQ51_01049 (thlA)
   00650 Butanoate metabolism
    KQ51_01049 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    KQ51_01049 (thlA)
   00072 Synthesis and degradation of ketone bodies
    KQ51_01049 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KQ51_01049 (thlA)
   00310 Lysine degradation
    KQ51_01049 (thlA)
   00380 Tryptophan metabolism
    KQ51_01049 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KQ51_01049 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KQ51_01049 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KQ51_01049 (thlA)
Enzymes [BR:mbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KQ51_01049 (thlA)
Exosome [BR:mbj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KQ51_01049 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1079044..1080255
Genome map
AA seq 403 aa AA seqDB search
MSKVYIVSAKRTPIGSFLGTLSKLHPAKYASDVVKNMLEETKVPAAEIDELVIGNILPAG
LGQGMGRQVSIGAGIPVEVPAYSLNMVCGSGMKSVMNSYVNIKANMFNLVIAGGTESMSK
APYLVPDKTRGGIKMGGFKLKDHMIDDALTDAFEQYHMGITAENIVDKYNLTREEQDAFA
INSQAKAIKAIDEGKFKDEIVPIEVKSRRETIIFENDEYPNRRTTLEKLGTLRAAFKKEG
SVTAGNSSGINDGASFVMVASEEAVKKYNLKPLVEIVSIGQGGVDPSIMGMGPVPAIKQA
LKNADMKLSEIDLLELNEAFAAQSLGVVTELVKQHDLTKEEIIERTNVNGGAIALGHPVG
ASGNRILVTLIHEMKKRNNANGLASLCIGGGMGTAIIVKNMEE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtttatattgtttccgcaaaaagaactcctattggtagttttttaggaaca
cttagtaagctgcatcctgcaaaatatgcaagtgatgtcgttaaaaacatgttagaagaa
acaaaagtacctgctgctgagattgatgaattagttataggtaatatcttacctgctggt
ttaggtcaaggtatgggtagacaagtttctattggtgcaggaattcctgttgaagtacct
gcttatagtttaaatatggtttgtggtagtggtatgaaatcagttatgaattcatacgtt
aatatcaaagcaaatatgtttaatttagtaattgctgggggaacagaatcaatgagtaag
gctccatacttagtcccagataaaactcgtggtggaattaaaatgggtggatttaaactt
aaagatcatatgattgatgatgctttaactgatgcatttgaacaatatcatatgggtatt
actgctgaaaatatcgttgataaatataatcttacaagagaagaacaagacgcatttgct
ataaattcacaagcaaaagcaattaaagctattgatgagggaaaatttaaagatgaaata
gttcctatcgaagtaaaatcaagaagagaaactatcatttttgaaaacgatgaatatcca
aatcgtcgaactacattagaaaaattgggaacattaagagctgctttcaaaaaagaaggt
agtgtaactgcgggtaactcttcaggaattaatgatggtgctagttttgttatggtagct
tcagaagaagcagttaaaaaatataatttaaaacctttagtagaaatcgtttctatagga
caaggtggagtagatccaagtattatgggtatgggtccagttcctgcaataaaacaagct
ttaaaaaatgctgatatgaaattatcagaaatagatttattagaattgaatgaagcattc
gcagcacaaagtttaggtgttgttactgaattagttaagcaacatgatttaactaaagaa
gaaatcatagaacgtactaacgtaaatggtggagctattgcattaggtcatccagttggt
gcaagtggaaatagaattttagtaacattaattcatgaaatgaaaaaacgaaacaatgca
aatggattagcttcattatgtattggtggcggtatgggtactgctataatcgttaaaaat
atggaggaataa

DBGET integrated database retrieval system