KEGG   Mycobacterium bovis BCG Korea 1168P: K60_000670Help
Entry
K60_000670        CDS       T02451                                 

Definition
cellulase celA1
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    K60_000670
Enzymes [BR:mbk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     K60_000670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65763..66686
Genome map
AA seq 307 aa AA seqDB search
MRVVRAPALILVDAANPLAGKPFYVDPASAAMVAARNANPPNAELTSVANTPQSYWLDQA
FPPATVGGTVARYTGAAQAAGAMPVLTLYGIPHRDCGSYASGGFATGTDYRGWIDAVASG
LGSSPATIIVEPDALAMADCLSPDQRQERFDLVRYAVDTLTRDPAAAVYVDAGHSRWLSA
EAMAARLNDVGVGRARGFSLNVSNFYTTDEEIGYGEAISGLTNGSHYVIDTSRNGAGPAP
DAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGEPQAGRFVSQYAID
LAHNAGQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtcgttcgggccccggcgttgatcctggtcgatgcggcaaacccgctggccgga
aagcccttctacgtcgatcccgcctcggcggccatggtcgccgcgcgcaacgccaacccg
ccgaacgccgagctgacctccgtcgccaacaccccgcagtcctactggctcgaccaggca
ttcccgccggcgaccgtcggcggcacggttgccaggtacaccggagcggcgcaggcggcc
ggcgccatgccggttctgacgctgtatggaatcccccatcgcgactgcggtagctacgca
tccggtgggttcgcgacgggcactgattaccgcgggtggatcgacgctgtcgcatccggc
ctgggctcatcgccggcgacgatcatcgtcgaacccgatgcgctggccatggccgactgc
ctgtcgcctgaccagcgccaggaacgtttcgacttggtgcgctacgccgtcgacacgctg
acccgcgacccggccgctgccgtgtacgtcgatgcggggcattcgcgctggctgagcgcc
gaggcaatggccgccaggctcaacgatgtcggtgtgggccgcgcgcgcgggtttagcctc
aacgtctcgaacttctacaccaccgatgaggaaatcggctatggcgaggcgatttcgggg
ctcacgaacggttcgcattacgtgatcgacacgtcgcgcaacggcgccggacccgcgccc
gacgccccgctcaactggtgtaaccccagcggccgcgccctgggcgcaccgcccaccacg
gcgaccgcgggcgcgcacgccgacgcttacctgtggatcaaacgtcccggggaatcggac
ggaacctgcggtcgcggggagcctcaggcgggtcggttcgttagccagtacgccatcgat
ctggcccacaacgccggccagtag

DBGET integrated database retrieval system