KEGG   Mycobacterium bovis BCG Korea 1168P: K60_003570Help
Entry
K60_003570        CDS       T02451                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
mbk00220  Arginine biosynthesis
mbk00250  Alanine, aspartate and glutamate metabolism
mbk00290  Valine, leucine and isoleucine biosynthesis
mbk01100  Metabolic pathways
mbk01110  Biosynthesis of secondary metabolites
mbk01130  Biosynthesis of antibiotics
mbk01210  2-Oxocarboxylic acid metabolism
mbk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    K60_003570
   00290 Valine, leucine and isoleucine biosynthesis
    K60_003570
   00220 Arginine biosynthesis
    K60_003570
Enzymes [BR:mbk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     K60_003570
    2.6.1.66  valine---pyruvate transaminase
     K60_003570
Amino acid related enzymes [BR:mbk01007]
 Aminotransferase (transaminase)
  Class I
   K60_003570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGE66267
Position
complement(403133..404422)
Genome map
AA seq 429 aa AA seqDB search
MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRAVVTRYELVPGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQ
PDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKEHASSFIEGIGLLANMR
LCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgatggcaccattgtggacgtgacaacccaccagctgccctggcacaccgcc
agccatcagcggcagcgcgccttcgctcagtcggccaagctgcaggacgtcctgtacgag
atccgcggcccggtgcaccagcacgccgcgcggctcgaagccgaaggtcaccgcatcctc
aaactcaacatcggcaacccggcgccgttcggcttcgaagcacccgacgtgatcatgcgc
gatatcatccaggcgctgccctacgcgcaggggtactccgactcgcagggcatcctgtcg
gcccggcgtgcggtggtcacgcgctacgagctggtgcccggatttccccgattcgacgtg
gacgacgtctacctgggtaacggggtctccgagctgatcacgatgacgctgcaagccctg
ctggacaacggcgatcaggtgctgattccatcaccggactacccgctgtggacggcgtcg
acctcgctggctggcggcactccggtccactacctgtgcgatgagacccaaggctggcag
cccgatatcgccgacctggaatccaagatcaccgagcgcaccaaggcgctggtcgtgatc
aaccccaacaacccaaccggcgcggtgtacagctgcgaaatcctcacccagatggtcgat
ctggcccgcaagcatcaactgctgctgttggcggacgaaatctacgacaaaatcctctac
gacgacgccaagcacatcagcctggcatcgatcgccccggatatgttgtgcctgaccttc
aatgggctgtcgaaggcctaccgcgtcgccggataccgggccggctggctggcgatcacc
ggacccaaggagcacgccagcagcttcatcgagggcatcggcctgctggccaatatgcgg
ttgtgcccaaatgtcccggcccagcatgccattcaggttgcactgggcggccatcagagc
atcgaggacctggtgctgcccggcggccggctgctcgagcagcgcgacatcgcctggacc
aagctcaacgagatcccgggggtgtcgtgcgtcaaaccggcgggcgcgctgtatgcgttt
ccccggctagaccccgaggtctacgacatcgacgacgacgagcaactcgtgctcgatctg
ctgctgtcggagaagatcctggtcacccagggcaccgggttcaactggcccgcaccggat
catctgcgcctggtgacgctgccatggtcccgcgatctggcggccgccatcgagcggctg
ggtaacttcctggtcagttaccggcaatag

DBGET integrated database retrieval system