KEGG   Mycobacterium bovis BCG Korea 1168P: K60_007750Help
Entry
K60_007750        CDS       T02451                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    K60_007750
Enzymes [BR:mbk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     K60_007750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(821639..822295)
Genome map
AA seq 218 aa AA seqDB search
MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLV
DAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEF
AIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVE
RTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgttgacgacccggaatccgcggtgctggcggccgccaaggacatgttgcgt
cggggcctggtcgaggggaccgccggaaatatctcagccaggcgctcggacggcaacgtg
gtcatcacgccgtcctcggtcgactacgccgagatgctgctccacgatctggtgctagtc
gacgccggcggtgcggtgctgcacgccaaggacggccggtcgccgtcgaccgaactaaac
ctacacctggcgtgctatcgcgcattcgacgacattggcagcgtgatccacagccacccg
gtgtgggcgaccatgttcgccgtcgcccatgagccgattcccgcctgcatcgacgagttc
gcgatctactgcggcggggacgttcgctgcaccgagtacgccgcgtccggtacacccgag
gtcggccgcaacgcggtgcgcgcgcttgagggccgcgccgccgccctgatcgccaaccac
ggcctggtggccgtggggccccgccccgaccaggtgctgcgcgtcaccgcccttgttgag
cgcaccgcacaaatcgtttggggtgcccgcgctctcggtggaccggtgccaattcctgag
gacgtgtgccgtaacttcacgggcgtctacggctatctgcgcgcgaatccgctctag

DBGET integrated database retrieval system