KEGG   Mycobacterium bovis BCG Korea 1168P: K60_010260Help
Entry
K60_010260        CDS       T02451                                 

Definition
Putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    K60_010260
Enzymes [BR:mbk01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     K60_010260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070693..1072072
Genome map
AA seq 459 aa AA seqDB search
MSPSNLPRTVGELRAAGHRERGVKQEIRENLLTALADGDNVWPGILGFDDTVIPQVERAL
IAGHDFVLLGERGQGKTRLLRALAGLLDEWTPVIAGAELGEHPYTPITPESIRRAAQLGD
DLPVAWKHRSERYTEKLATPDTSVADLVGDVDPIKVAEGRSLGDPETIAYGLIPRAHRGI
VAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPI
KDRFGAEIRTHYPLELEAEMGVIVQEAHLSAQVPDYLMQVLARFARYLRESRSIDQRSGV
SARFAIAAAETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGREQAVL
EHLLRRATADTASRVLGGIDVGSLVTAVEGGSAVTTGERVSAKDVLAAVPGLPVVDRIAR
KLGAESEGERAAALELALEALYLAKRVDKVCGEGQTVYG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccagtaacctgccccgcaccgtgggcgagctgcgtgccgccggtcatcgggaa
cggggggtcaagcaggaaatccgggaaaatctgctgaccgcgctggccgacggcgacaac
gtctggccgggcatcctgggtttcgacgacaccgtgattccccaggtggagcgggccttg
atcgccggtcacgactttgtcctgctcggcgaacgcggccagggcaagacccggctgctg
cgcgcactcgcgggtctgctggacgagtggacgccggtgatcgccggcgccgaactgggc
gagcacccctacacgccgatcacgccggagtcgatccggcgggccgcgcagctcggcgac
gacctaccggtggcgtggaagcaccgcagcgagcgctacaccgagaagctggccaccccc
gacaccagcgtcgccgacctggtcggcgacgtcgacccgatcaaggttgccgagggccgc
agcctcggggatcccgaaaccatcgcctacgggctcatcccgcgggcgcaccgcggcatc
gtcgcggtcaacgagctgcccgacctcgccgaacgcatccaggtgtcgatgctcaacgtc
atggaggagcgcgacatccaggtccgcggctacacgctgcggctgccgctggatgtgttg
gtggtcgccagcgccaaccccgaggactacaccaaccgtggccgcatcatcacgcccatc
aaggaccggttcggcgccgagatccgcacccactacccactggagctggaggcggagatg
ggcgtcatcgtccaggaggcgcacctgagtgcacaggtgcccgactacctgatgcaggtg
ctcgcgcggtttgcccgttacctgcgagaatcccgctcgatcgatcagcgctccggggtg
tcggcgcggtttgccatcgcagcggccgaaaccgtggcggctgccgcccggcaccgcggg
gcggtgctgggggagacagacccggtggcccgggtggtcgatttgggcacggtgatcgac
gtgctgcgcggcaagctggaattcgagtccggcgaggagggccgcgaacaggcggtgctc
gagcatctgttgcgtcgcgccaccgccgataccgcgtcccgggtgctgggcggtatcgac
gttggctcgttggtgaccgcggtcgagggcggttcggcggtgacgacgggcgagcgggtc
tcggccaaggatgtgctggcggcggtgccgggcctgccggtggtggacaggatcgcgcgc
aagctgggcgccgaatccgagggggagcgtgccgcggcactggaactggcgttggaggcg
ctatacctggccaagcgcgttgacaaggtctgcggggagggccagaccgtctatggctaa

DBGET integrated database retrieval system