KEGG   Mycobacterium bovis BCG Korea 1168P: K60_010830Help
Entry
K60_010830        CDS       T02451                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase ispE
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K60_010830
Enzymes [BR:mbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     K60_010830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1130977..1131933
Genome map
AA seq 318 aa AA seqDB search
MSASDGNTAELWVPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRN
ADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSA
DAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTF
HWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQA
AAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVR
VATGPVPGARVVSAPTEV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcatctgacggcaacaccgctgaattgtgggtgcccaccgggtcggtcaccgtt
cgggtgcccggaaaggtcaacctctatctggcggtcggcgatcgccgcgaggacggctat
cacgagctgaccacggtatttcatgccgtctcgctggtcgacgaggtaaccgttcgtaac
gctgatgtgctctcgctcgagttggtcggcgagggggccgaccagctgccgaccgacgaa
cgcaatctcgcctggcaggcggccgagctgatggccgaacacgtgggccgggcgccggac
gtctcgatcatgatcgacaaatccattccggtcgccggcggcatggccggtggcagcgcg
gacgctgcggcggtcctggttgcgatgaactcgttgtgggaactcaatgtgccccgccgc
gacctgcgcatgctcgccgcgcggctaggcagcgatgtgccgtttgccctgcatggtggt
accgcgctggggacgggtcgcggcgaggagttggccaccgtgttatcccgcaacaccttc
cactgggtcctggcgttcgccgacagcgggttgctcacctccgcggtgtacaacgagctc
gaccggctcagggaggtgggggatccgccccggcttggtgagcccgggccggttctggct
gccttagctgcgggtgatccggatcagctggcgccgttgctgggtaatgaaatgcaagcg
gccgcggtgagcctggacccggcgctggctcgtgcgttacgcgccggtgtggaggccggc
gcgctcgcaggcatcgtgtccggttcgggtcccacgtgtgccttcctgtgcacctcggcg
agctcggcgatcgatgtcggcgcgcagctgtcgggggcgggagtttgtcgcaccgttcga
gtcgccaccgggccggtacccggcgcccgcgtggtgtctgcgccgaccgaagtgtga

DBGET integrated database retrieval system