KEGG   Mycobacterium bovis BCG Korea 1168P: K60_016940Help
Entry
K60_016940        CDS       T02451                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase trpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
mbk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbk01100  Metabolic pathways
mbk01110  Biosynthesis of secondary metabolites
mbk01130  Biosynthesis of antibiotics
mbk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    K60_016940
Enzymes [BR:mbk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     K60_016940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh
Motif
Other DBs
NCBI-ProteinID: AGE67604
Position
1785684..1786532
Genome map
AA seq 282 aa AA seqDB search
MGDSGKGTAGMSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREP
GIGVIAEVKRASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRA
SVSIPVLRKDFVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVH
TEQEADRALKAGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLA
YAGAGADAVLVGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacagtgggaagggaacggcaggcatgagtccggcaaccgtgctcgactccatc
ctcgagggagtccgggccgacgttgccgcgcgtgaagcctcggtgagcctgtcggagatc
aaggctgccgccgctgcggcgccgccgccgctcgacgtgatggccgccctacgcgagccc
ggcatcggcgtcatcgctgaggtcaagcgcgctagtccttcggcaggcgcattggcgacc
atcgccgacccggcaaagctggcccaggcctaccaggatggcggtgcccggatcgtcagc
gtggtgactgagcagcggcgttttcagggatcgctcgacgacctcgacgcggtgcgggcc
tcggtttcgattccggtgctgcgcaaggactttgtggtgcagccgtaccagattcatgag
gcgcgtgcgcacggcgccgacatgttgttgctcatcgtcgccgcattggagcagtcggtg
ttggtgtcgatgttggaccgcaccgaatcgttgggtatgacagcactcgtcgaggtccat
accgagcaggaagccgaccgagcgctgaaggccggggccaaggtgattggcgttaacgcc
cgcgacctcatgacgctggacgtggaccgggattgcttcgcgcgaatagctcctggtttg
ccgagcagtgtgatcaggattgctgaatccggcgtgcgtggcaccgctgacctgctggcg
tacgccggcgcgggcgctgacgcggtgttggtaggcgaaggtctggtcaccagcggcgac
ccacgtgccgcggttgccgatctggttaccgcgggcacccatccgtcctgtccgaaaccg
gctcgctag

DBGET integrated database retrieval system