KEGG   Mycobacterium bovis BCG Korea 1168P: K60_018670Help
Entry
K60_018670        CDS       T02451                                 

Definition
4-alpha-glucanotransferase malQ
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    K60_018670
Enzymes [BR:mbk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     K60_018670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1986462..1988702)
Genome map
AA seq 746 aa AA seqDB search
MLTEGSDSCARPHTGAGRKMGDMTELAPSLVELTRRFGIATEYTDWTGRQVLVSEATLVA
ALAALGVPAQTEQQRNDALAAQLRSYWARPLPATIVMRAGEQTQFRVHVTDGAPADVWLQ
LEDGTTRAEVVQVDNFTPPFDLDGRWIGEASFVLPADLPLGYHRVNLRSGDSQASAAVVV
TPDWLGLPDKLAGRRAWGLAVQLYSVRSRQSWGIGDLTDLANLALWSASAHGAGYVLVNP
LHAATLPGPAGRSKPIEPSPYLPTSRRFVNPLYLRVEAIPELVDLPKRGRVQRLRTNVQQ
HADQLDTIDRDSAWAAKRAALKLVHRVPRSAGRELAYAAFRTREGRALDDFATWCALAET
YGDDWHRWPKSLRHPDASGVADFVDKHADAVDFHRWLQWQLDEQLASAQSQALRAGMSLG
IMADLAVGVHPNGADAWALQDVLAQGVTAGAPPDEFNQLGQDWSQPPWRPDRLAEQEYRP
FRALIQAALRHAGAVRIDHIIGLFRLWWIPDGAPPTQGTYVRYDHDAMIGIVALEAHRAG
AVVVGEDLGTVEPWVRDYLLLRGLLGTSILWFEQDRDCGPAGTPLPAERWREYCLSSVTT
HDLPPTAGYLAGDQVRLRESLGLLTNPVEAELESARADRAAWMAELRRVGLLADGAEPDS
EEAVLALYRYLGRTPSRLLAVALTDAVGDRRTQNQPGTTDEYPNWRVPLTGPDGQPMLLE
DIFTDRRAATLAEAVRAATTSPMSCW
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacggaaggctcagattcctgcgctcgcccgcacacgggtgccggacgcaagatg
ggcgacatgaccgagctcgcgccttcgctggtcgaacttacccgacgattcggcattgcc
accgagtacacggactggactggccggcaggtgctggtctccgaggctacattggtggct
gctcttgccgccctcggcgttcccgcccagaccgaacagcaacgcaatgacgccctggcc
gcgcagctgcggtcctactgggcgcgtccattgccggcgaccatcgtcatgcgcgccgga
gagcagacgcagttcagggtgcatgtgaccgatggcgctccggccgacgtgtggttgcag
ctcgaggacggcacgacacgtgccgaggtggtgcaggtcgacaatttcaccccgccattc
gatcttgacggacgctggatcggcgaggccagcttcgtgttgcccgccgacctgcccctc
ggctaccaccgggtgaatctgcgttcgggcgactcgcaggccagcgccgctgttgtcgtg
acgccggattggttggggctgccggacaagctggcaggccgtcgtgcctggggcctggcc
gtccagctctacagcgtgcggtcccggcagtcatggggcatcggggatctcaccgatttg
gcgaatctcgcgctgtggtcggcgtctgcgcacggtgccggctatgtgctggtcaatccc
ctgcatgcggctacgcttcccgggcccgctgggcgctcgaagccaatcgaaccatcgccc
tacctgccgacatcgcgacgcttcgtcaaccctctctaccttcgggtggaggccattccg
gaactcgtcgatctgcccaagcgtggccgggtgcaacggttgcgcaccaacgtgcaacag
cacgccgaccagctcgacaccattgaccgcgacagcgcctgggcggccaaacgcgcagca
ctcaagctcgtgcaccgggtgccgcggtcggcgggtcgcgagctggcctacgccgccttc
cgtacccgcgagggccgcgccctcgacgacttcgccacctggtgcgcgctggccgagacg
tacggcgatgattggcatcgatggccgaaatcgctgcggcatcccgatgcctcaggtgtc
gccgatttcgtcgacaaacacgccgatgccgtcgatttccaccgctggctgcagtggcag
ctggacgagcagctcgccagtgcgcagtcgcaggcgctccgggccggcatgtcgctgggc
atcatggcagacctcgccgttggcgtgcaccccaacggggccgacgcctgggctctgcag
gacgtgctggcccaaggtgtgaccgcaggtgcgccgccggatgagttcaaccaactcggc
caggactggtcgcagccaccgtggcggccggaccggctcgctgagcaggagtaccgaccg
tttcgcgcgctgatccaggccgcgttgcggcacgccggtgcggtacgcatcgaccacatc
atcgggctgttccggttgtggtggatccccgacggcgcaccgcccacccaaggcacctat
gtgcgctacgaccacgacgcgatgatcggcatcgtcgccctggaagcccaccgggccggg
gcggttgtcgtcggtgaggatctcggcaccgtcgagccgtgggtacgcgactatctacta
ttgcggggcctgctgggcacctcaattctctggtttgagcaggatcgagattgcgggccg
gctggaacaccattgccggccgaacgctggcgggagtactgcttgtcgtcggtgaccacc
catgatctgccgccgaccgccggctacctggccggcgaccaggtacggctgcgcgagtcc
cttgggttgttaaccaaccccgtggaggcggaactcgaatccgcccgggccgaccgggca
gcctggatggccgagctgcgccgggtcggactgctggcggacggtgccgagcccgactcg
gaggaggccgtcctggctctctaccgctacctgggccgaacgccctcgcggctgttggca
gtggcgttgaccgatgcggtcggcgaccgccggacgcaaaaccagcctggcaccaccgac
gagtacccgaactggcgggtgccgctcaccggccccgacggtcagccgatgctgctcgag
gacatcttcaccgatcgcagggcagccaccttggccgaggcggtgcgcgctgcgacgacc
tcaccgatgagctgttggtga

DBGET integrated database retrieval system