KEGG   Mycobacterium bovis BCG Korea 1168P: K60_025350Help
Entry
K60_025350        CDS       T02451                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    K60_025350
  Amino acid metabolism
   00330 Arginine and proline metabolism
    K60_025350
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    K60_025350
Enzymes [BR:mbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     K60_025350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2671932..2673014)
Genome map
AA seq 360 aa AA seqDB search
MKVGTTALTTPSGMFDAGRLAGLAEAVERRMKAGSDVVIVSSGAIAAGIEPLGLSRRPKD
LATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLTAHDISMRVQHTNAQRTLDRLRALH
AVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDIDGLYDCDPRKTADATFI
PEVSGPADLDGVVAGRSSHLGTGGMASKVSAALLAADAGVPVLLAPAADAATALADASVG
TVFAARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSLLAAGITAVSGRFCGGD
VVELRAPDAAMVARGVVAYDASELATMVGRSTSELPGELRRPVVHADDLVAVSAKQAKQV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgggaccacggcgcttaccacaccgtccgggatgttcgatgccggccggctg
gccggactggccgaggcggtcgagcggcggatgaaggcgggttccgacgtcgtcatcgtg
tcttcgggcgccatcgccgccggcatcgagccgctcgggctgtcccgtcgtcccaaagat
ctggcgaccaagcaggcggcggccagcgtcgggcaggtcgcgctggtgaactcgtggagc
gcggcgttcgcccgctacggccgcacggtgggccaggtgctgctgaccgcgcacgacatt
tcgatgcgggtgcagcacaccaacgcccaacgcacgctggatcggctgcgcgcgttgcac
gcggtggcgattgtcaacgagaacgacaccgtggccaccaacgagatccggttcggtgac
aacgatcggctgtctgcactggtggcgcacctggtcggcgccgacgctttggtgctgctg
tcggacatcgacggcctctacgactgcgacccgcgcaaaaccgcggacgcgacgttcatt
ccggaggtgtccgggccggcggatctggacggtgtggtcgccggccgcagtagccacctg
ggtactggcggcatggcgtccaaggtgtcggcggcgctgttggccgccgacgccggggtg
ccggtactgctggcccccgcggccgacgccgcgaccgcgctcgccgacgcgtcggtgggc
acggtgtttgcggcccggcccgcgcgtctgtcggcccggcggttctgggtgcgttatgcc
gccgaagcaaccggcgcactgactctcgacgccggtgcggtgcgcgctgtggtgcgacaa
cgccggtcactgctggcggcgggtatcaccgcggtgtccggccggttttgcggcggcgat
gtggtcgaactgcgtgcacccgacgcggccatggtagcccgcggggtggttgcctacgac
gcgtccgagctggccaccatggtgggccggtccacctctgagctacccggcgagctgcgc
cgcccggtggtgcacgccgacgatctggtcgcggtgtcggcgaagcaagctaagcaagtt
tag

DBGET integrated database retrieval system