KEGG   Mycobacterium bovis BCG Korea 1168P: K60_027690Help
Entry
K60_027690        CDS       T02451                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
mbk00860  Porphyrin and chlorophyll metabolism
mbk01100  Metabolic pathways
mbk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    K60_027690
Enzymes [BR:mbk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     K60_027690
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     K60_027690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 Rossmann-like
Motif
Other DBs
NCBI-ProteinID: AGE68679
Position
complement(2915865..2917223)
Genome map
AA seq 452 aa AA seqDB search
MTPRSYCVVGGGISGLTSAYRLRQAVGDDATITLFEPADRLGGVLRTEHIGGQPMDLGAE
AFVLRRPEMPALLAELGLSDRQLASTGARPLIYSQQRLHPLPPQTVVGIPSSAGSMAGLV
DDATLARIDAEAARPFTWQVGSDPAVADLVADRFGDQVVARSVDPLLSGVYAGSAATIGL
RAAAPSVAAALDRGATSVTDAVRQALPPGSGGPVFGALDGGYQVLLDGLVRRSRVHWVRA
RVVQLERGWVLRDETGGRWQADAVILAVPAPRLARLVDGIAPRTHAAARQIVSASSAVVA
LAVPGGTAFPHCSGVLVAGDESPHAKAITLSSRKWGQRGDVALLRLSFGRFGDEPALTAS
DDQLLAWAADDLVTVFGVAVDPVDVRVRRWIEAMPQYGPGHADVVAELRAGLPPTLAVAG
SYLDGIGVPACVGAAGRAVTSVIEALDAQVAR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactccccgctcgtattgtgttgtaggaggcgggatttcgggattgacctcggcgtac
cggctgcggcaggctgtcggcgatgacgcgaccatcaccttgttcgaaccggccgatagg
ctcggcggggtattgcgcaccgagcatatcggcggacagccaatggacctcggcgcggag
gcgttcgtgctgcgtaggcccgagatgccggcgcttttggccgagctgggcctgtcggac
cgccaactcgccagcaccggcgcgcggccgctcatctacagccagcagcgcttgcacccg
ctgccgccgcagacggtcgtcgggatcccgtcgtcggcgggctccatggcggggctggtc
gacgacgcaaccctggcgcggatcgacgccgaagccgctcgtccgttcacctggcaggtg
ggcagcgatcccgcggtggccgacttggtggctgaccggttcggcgaccaagtcgtggcc
cggtcggtggacccgctgttaagcggggtatacgcgggctcggcggcgacgatcgggctg
cgcgcggccgccccgagcgtggccgcggccctggatcgcggggcgaccagtgtgaccgac
gcggtccggcaggcgctgccgccgggaagcggcgggccggtgttcggcgcgctggacggc
gggtatcaggtgctgctcgacgggctcgtccggcgcagccgggtgcactgggtgcgggcc
agggtggtccagctcgaacgcggctgggtgctgcgcgacgaaaccggcggccgctggcag
gccgacgccgtcatcctggcggttccggcgccgcggttggcgcgcctcgtcgatggcatc
gcgccgcgcacacatgccgccgcccggcagatcgtgagcgcgtcgtcggcggtggtggcg
ctggcggtgcccggcggcaccgcgtttccgcactgttccggcgtgctggtggccggcgac
gagtcaccgcatgccaaggcgatcacattgtcgtcgcgcaaatggggtcagcgcggcgac
gtcgcgctgttgcggctgtcgttcggtcggttcggcgacgaaccggccctgacggcctcc
gacgaccaactcctggcctgggcagcggacgacttggtcacggtgttcggtgtggccgtc
gacccggtcgacgttcgggtccggcgctggatcgaggcgatgccgcagtacggtcccggc
catgccgatgtggtcgccgagctgcgcgccggcctgccaccgacgctggccgttgcgggc
agctacctcgacgggatcggcgtgccggcctgcgtcggcgcggcgggccgggccgtcacc
agcgtcatcgaggccttagatgcgcaggtggcacgatag

DBGET integrated database retrieval system