KEGG   Mycobacterium bovis BCG Korea 1168P: K60_030290Help
Entry
K60_030290        CDS       T02451                                 

Definition
(RefSeq) formamidopyrimidine-DNA glycosylase fpg
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    K60_030290
Enzymes [BR:mbk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     K60_030290
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     K60_030290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3162293..3163213)
Genome map
AA seq 306 aa AA seqDB search
MVMTRCARLRRACDHHWMPELPEVEVVRRGLQAHVTGRTITEVRVHHPRAVRRHDAGPAD
LTARLRGARINGTDRRGKYLWLTLNTAGVHRPTDTALVVHLGMSGQMLLGAVPCAAHVRI
SALLDDGTVLSFADQRTFGGWLLADLVTVDGSVVPVPVAHLARDPLDPRFDCDAVVKVLR
RKHSELKRQLLDQRVVSGIGNIYADEALWRAKVNGAHVAATLRCRRLGAVLHAAADVMRE
ALAKGGTSFDSLYVNVNGESGYFERSLDAYGREGENCRRCGAVIRRERFMNRSSFYCPRC
QPRPRK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgacccgctgcgcccggcttcgccgcgcttgcgatcatcactggatgcccgag
ctgcccgaagtcgaggtggtgcggcgcggcttgcaggctcacgtgaccggccggaccatc
accgaggttcgggtgcaccacccccgcgctgtgcgccgccacgatgccgggcccgcggat
ctgacggcgcggctgcggggagcgcggatcaacggaaccgatcggcgcggcaagtacctg
tggttgacactcaatacggctggggtccataggccgacggacaccgcactcgtggtgcac
ctgggcatgagtgggcagatgctgctcggggcggtgccgtgtgccgctcacgtccggatt
tccgcgctgctcgacgacgggaccgtgctgagcttcgctgaccaacggaccttcggaggg
tggctgcttgccgacctggtgacggtggacggcagcgtggtaccggtgccggtcgcccac
ctggcgcgcgacccgcttgacccgcggttcgattgtgacgctgtagttaaagtgttgcgg
cgcaagcattccgaactcaagcgccagctgctggatcagcgggtggtgtcgggaatcggc
aacatctatgccgatgaggcgctgtggcgggccaaggtgaacggcgcccacgtcgccgcc
acactaaggtgccggcgtctgggagcggtcctgcatgccgccgccgacgtgatgcgcgaa
gcgctggcgaaaggtggcacctcgttcgactctttgtatgtcaacgtcaacggcgagtcg
ggctacttcgagcggtcgctggacgcttatggccgcgaaggcgaaaactgtcggcgctgc
ggcgcggtgatacgccgggagaggtttatgaaccgctcgtcgttctactgcccgcgatgc
cagccgcggccccgaaagtag

DBGET integrated database retrieval system