KEGG   Mycobacterium bovis BCG Korea 1168P: K60_035470Help
Entry
K60_035470        CDS       T02451                                 

Definition
(GenBank) cholesterol oxidase precursor choD
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
mbk00984  Steroid degradation
mbk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    K60_035470
Enzymes [BR:mbk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     K60_035470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_binding_3 Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGE69457
Position
complement(3818892..3820661)
Genome map
AA seq 589 aa AA seqDB search
MARCKGGHTAAMKPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFSDEEFAKTSW
DLRKFLWAPRLGCYGIQRIHPLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADQQWSHI
TDWRGELMPHYQQAQRMLGVVQNPTFTDADRIVKEVADEMGFGDTWVPTPVGVFFGPDGT
KTPGKTVPDPYFGGAGPARTGCLECGCCMTGCRHGAKNTLVKNYLGLAESAGAQVIPMTT
VKGFERRSDGLWEVRTVRTGSWLRRDRRTFTATQLVLAAGTWGTQHLLFKMRDRGRLPGL
SKRLGVLTRTNSESIVGAATLKVNPDLDLTHGVAITSSIHPTADTHIEPVRYGKGSNAMG
LLQTLMTDGSGPQGTDVPRWRQLLQTASQDPRGTIRMLNPRQWSERTVIALVMQHLDNSI
TTFTKRGKLGIRWYSSKQGHGEPNPTWIPIGNQVTRRIAAKIDGVAGGTWGELFNIPLTA
HFLGGAVIGDDPEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSIAAQAERAASLW
PNKGETDRRPPQGEPYRRLAPIQPAHPVVPADAPGALRWLPIDPVSNAG
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
ctggcccgatgtaaagggggtcatactgcagcgatgaagccggattacgacgtcctgatt
attggatcgggtttcgggggcagcgtcaccgcgctgcggctgacggaaaagggctaccgg
gtcggcgtgctggaggccggccgccggttctccgacgaggagttcgccaagacgtcgtgg
gacctgcgcaagtttctctgggcgccgaggttgggctgctatggcattcaacgtatccac
ccgctgcgcaacgtgatgatcctggccggcgccggggtgggcgggggctccctcaactac
gccaacacgttgtacgtgccgccggagccgttcttcgccgaccagcagtggtcacacatc
accgactggcgtggcgagctgatgccgcactaccagcaggcgcagcggatgctcggggtg
gtgcaaaacccgaccttcaccgacgccgaccgcatcgtcaaggaggtcgccgacgagatg
gggtttggcgacacctgggtgccgaccccggttggagtgttcttcggccccgacggcacc
aagacgcccggcaagaccgtgcccgatccctacttcggcggtgccgggccggcgcgcacc
ggctgcctggaatgcggctgctgtatgacgggctgtcgccacggtgccaagaacaccctg
gtgaaaaactaccttggcctcgcggaatcagctggcgcgcaagtgattccgatgaccacg
gtgaaggggtttgagcggcggtccgacgggttgtgggaggtccgcacagtgcgaaccggc
agttggctgcgccgggatcggcgcaccttcaccgcaacgcagctggtgctggccgcgggc
acctgggggacccagcatctgctgttcaagatgcgggataggggtcggctccctggtctc
tcgaagcgattgggtgtccttacccgcaccaactcagaatcgatcgtcggggccgccacc
ttgaaggtcaatccggacctggacctgacccacggcgtggcgatcacgtcgtcgattcac
ccgacggccgacacccacatcgaacccgtgcgctacggcaaaggctccaacgcgatgggg
ctgctgcagaccttgatgaccgacggctccggtccgcagggcaccgatgtgccgcgctgg
aggcagttgctgcagaccgccagtcaggatccgcgcggcaccatccggatgctcaatccc
cggcaatggagcgagcgcaccgtgatcgcgctggtcatgcagcacctggacaactcgatc
accacgttcaccaagcgcgggaagctgggtatccgctggtactcgagcaagcagggacac
ggcgagccgaaccctacatggatcccgatcggcaaccaggtcacccgtcgcatcgccgcc
aaaatcgacggcgtggccggcggcacctggggtgagctgttcaacatcccgctcaccgcg
cactttctcggcggcgcggtgatcggcgacgaccccgagcacggcgtcatcgacccctat
caccgggtctatggctatccgacgctgtacgtggttgacggtgcggcgatctcggcgaac
ctgggtgtcaacccgtcgctgtccatcgccgctcaagccgagcgggccgcctcgctgtgg
ccgaacaagggcgaaaccgaccggcggccaccgcagggtgagccctatcgtcggctggcg
ccgatccaaccggcgcacccggtggtgcctgccgacgccccgggcgcgctgcggtggttg
ccgatcgatccggtcagcaacgcgggctga

DBGET integrated database retrieval system