KEGG   Mycobacterium bovis BCG Korea 1168P: K60_035470Help
Entry
K60_035470        CDS       T02451                                 

Definition
cholesterol oxidase precursor choD
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:mbk00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3818892..3820661)
Genome map
AA seq 589 aa AA seqDB search
MARCKGGHTAAMKPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFSDEEFAKTSW
DLRKFLWAPRLGCYGIQRIHPLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADQQWSHI
TDWRGELMPHYQQAQRMLGVVQNPTFTDADRIVKEVADEMGFGDTWVPTPVGVFFGPDGT
KTPGKTVPDPYFGGAGPARTGCLECGCCMTGCRHGAKNTLVKNYLGLAESAGAQVIPMTT
VKGFERRSDGLWEVRTVRTGSWLRRDRRTFTATQLVLAAGTWGTQHLLFKMRDRGRLPGL
SKRLGVLTRTNSESIVGAATLKVNPDLDLTHGVAITSSIHPTADTHIEPVRYGKGSNAMG
LLQTLMTDGSGPQGTDVPRWRQLLQTASQDPRGTIRMLNPRQWSERTVIALVMQHLDNSI
TTFTKRGKLGIRWYSSKQGHGEPNPTWIPIGNQVTRRIAAKIDGVAGGTWGELFNIPLTA
HFLGGAVIGDDPEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSIAAQAERAASLW
PNKGETDRRPPQGEPYRRLAPIQPAHPVVPADAPGALRWLPIDPVSNAG
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
ctggcccgatgtaaagggggtcatactgcagcgatgaagccggattacgacgtcctgatt
attggatcgggtttcgggggcagcgtcaccgcgctgcggctgacggaaaagggctaccgg
gtcggcgtgctggaggccggccgccggttctccgacgaggagttcgccaagacgtcgtgg
gacctgcgcaagtttctctgggcgccgaggttgggctgctatggcattcaacgtatccac
ccgctgcgcaacgtgatgatcctggccggcgccggggtgggcgggggctccctcaactac
gccaacacgttgtacgtgccgccggagccgttcttcgccgaccagcagtggtcacacatc
accgactggcgtggcgagctgatgccgcactaccagcaggcgcagcggatgctcggggtg
gtgcaaaacccgaccttcaccgacgccgaccgcatcgtcaaggaggtcgccgacgagatg
gggtttggcgacacctgggtgccgaccccggttggagtgttcttcggccccgacggcacc
aagacgcccggcaagaccgtgcccgatccctacttcggcggtgccgggccggcgcgcacc
ggctgcctggaatgcggctgctgtatgacgggctgtcgccacggtgccaagaacaccctg
gtgaaaaactaccttggcctcgcggaatcagctggcgcgcaagtgattccgatgaccacg
gtgaaggggtttgagcggcggtccgacgggttgtgggaggtccgcacagtgcgaaccggc
agttggctgcgccgggatcggcgcaccttcaccgcaacgcagctggtgctggccgcgggc
acctgggggacccagcatctgctgttcaagatgcgggataggggtcggctccctggtctc
tcgaagcgattgggtgtccttacccgcaccaactcagaatcgatcgtcggggccgccacc
ttgaaggtcaatccggacctggacctgacccacggcgtggcgatcacgtcgtcgattcac
ccgacggccgacacccacatcgaacccgtgcgctacggcaaaggctccaacgcgatgggg
ctgctgcagaccttgatgaccgacggctccggtccgcagggcaccgatgtgccgcgctgg
aggcagttgctgcagaccgccagtcaggatccgcgcggcaccatccggatgctcaatccc
cggcaatggagcgagcgcaccgtgatcgcgctggtcatgcagcacctggacaactcgatc
accacgttcaccaagcgcgggaagctgggtatccgctggtactcgagcaagcagggacac
ggcgagccgaaccctacatggatcccgatcggcaaccaggtcacccgtcgcatcgccgcc
aaaatcgacggcgtggccggcggcacctggggtgagctgttcaacatcccgctcaccgcg
cactttctcggcggcgcggtgatcggcgacgaccccgagcacggcgtcatcgacccctat
caccgggtctatggctatccgacgctgtacgtggttgacggtgcggcgatctcggcgaac
ctgggtgtcaacccgtcgctgtccatcgccgctcaagccgagcgggccgcctcgctgtgg
ccgaacaagggcgaaaccgaccggcggccaccgcagggtgagccctatcgtcggctggcg
ccgatccaaccggcgcacccggtggtgcctgccgacgccccgggcgcgctgcggtggttg
ccgatcgatccggtcagcaacgcgggctga

DBGET integrated database retrieval system