KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_0063Help
Entry
BCGMEX_0063       CDS       T01727                                 

Gene name
celA1
Definition
putative cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mbm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65544..66686
Genome map
AA seq 380 aa AA seqDB search
MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMSSAIGSVARWIVPLLG
VAAVASIGVIAAPVRVVRAPALILVDAANPLAGKPFYVDPASAAMVAARNANPPNAELTS
VANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYGIPHRDCGSYASGGFATG
TDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQERFDLVRYAVDTLTRDPAAA
VYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTTDEEIGYGEAISGLTNGSHY
VIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGE
PQAGRFVSQYAIDLAHNAGQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtcggactgggcagcgatggcgcgggactctgcccgggcgccggccttggaca
cggccagcgcccgccacctgtcgtcggcatttggcgtttgtcgaattgcggcattatttt
gctcgggtgatgtcatcagctattggttcggtcgcgcggtggatagtccccctcctgggg
gttgcagccgttgcttccatcggtgttatcgcggccccggtgcgggtcgttcgggccccg
gcgttgatcctggtcgatgcggcaaacccgctggccggaaagcccttctacgtcgatccc
gcctcggcggccatggtcgccgcgcgcaacgccaacccgccgaacgccgagctgacctcc
gtcgccaacaccccgcagtcctactggctcgaccaggcattcccgccggcgaccgtcggc
ggcacggttgccaggtacaccggagcggcgcaggcggccggcgccatgccggttctgacg
ctgtatggaatcccccatcgcgactgcggtagctacgcatccggtgggttcgcgacgggc
actgattaccgcgggtggatcgacgctgtcgcatccggcctgggctcatcgccggcgacg
atcatcgtcgaacccgatgcgctggccatggccgactgcctgtcgcctgaccagcgccag
gaacgtttcgacttggtgcgctacgccgtcgacacgctgacccgcgacccggccgctgcc
gtgtacgtcgatgcggggcattcgcgctggctgagcgccgaggcaatggccgccaggctc
aacgatgtcggtgtgggccgcgcgcgcgggtttagcctcaacgtctcgaacttctacacc
accgatgaggaaatcggctatggcgaggcgatttcggggctcacgaacggttcgcattac
gtgatcgacacgtcgcgcaacggcgccggacccgcgcccgacgccccgctcaactggtgt
aaccccagcggccgcgccctgggcgcaccgcccaccacggcgaccgcgggcgcgcacgcc
gacgcttacctgtggatcaaacgtcccggggaatcggacggaacctgcggtcgcggggag
cctcaggcgggtcggttcgttagccagtacgccatcgatctggcccacaacgccggccag
tag

DBGET integrated database retrieval system