KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_0478Help
Entry
BCGMEX_0478       CDS       T01727                                 

Gene name
icl
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mbm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mbm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558676..559962
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQL
HDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA
VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD
LAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgtcggcaccccgaagagcgcggagcagatccagcaggaatgggacacgaac
ccgcgctggaaggacgtcacccgcacctactccgccgaggacgtcgtcgccctccagggc
agcgtggtcgaggagcacacgctggcccgccgcggtgcggaggtgctgtgggagcagctg
cacgacctcgagtgggtcaacgcgctgggcgcgctgaccggcaacatggccgtccagcag
gtgcgcgccggcctgaaggccatctacctgtcgggctggcaggtcgccggcgatgccaac
ctgtccgggcacacctaccccgaccagagcctgtatcccgccaactcggtgccgcaggtg
gtccgccggatcaacaacgcactgcagcgcgccgaccagatcgccaagatcgagggcgat
acttcggtggagaactggctggcgccgattgtcgccgacggcgaggccggctttggcggc
gcgctcaacgtctacgagctgcagaaagccctgatcgccgcgggcgttgcgggttcgcac
tgggaggaccagttggcctctgagaagaagtgcggccacctgggcggcaaggtgttgatc
ccgacccagcagcacatccgcactttgacgtctgctcggctcgcggccgatgtggctgat
gttcccacggtggtgatcgcccgtaccgacgccgaggcggccacgctgatcacctccgac
gtcgacgagcgcgaccagccgttcatcaccggcgagcgcacccgggaaggcttctaccgc
accaagaacggcatcgagccttgcatcgctcgggcgaaggcctacgccccgttcgccgac
ttgatctggatggagaccggtaccccggacctcgaggccgcccggcagttctccgaggcg
gtcaaggcggagtacccggaccagatgctggcctacaactgctcgccatcgttcaactgg
aaaaagcacctcgacgacgccaccatcgccaagttccagaaggagctggcagccatgggc
ttcaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttcgat
ctggcctacggctacgcccagaaccagatgagcgcgtatgtcgaactgcaggaacgcgag
ttcgccgccgaagaacggggctacaccgcgaccaagcaccagcgcgaggtcggtgccggc
tacttcgaccggattgccaccaccgtggacccgaattcgtcgaccaccgcgttgaccggt
tccaccgaagagggccagttccactag

DBGET integrated database retrieval system