KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_0526Help
Entry
BCGMEX_0526       CDS       T01727                                 

Gene name
hemB
Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
mbm00860  Porphyrin and chlorophyll metabolism
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
Module
mbm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCGMEX_0526 (hemB)
Enzymes [BR:mbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BCGMEX_0526 (hemB)
Exosome [BR:mbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCGMEX_0526 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase
Motif
Other DBs
NCBI-ProteinID: AET17814
Position
605734..606723
Genome map
AA seq 329 aa AA seqDB search
MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGIDEPRPITSMPGVVQHT
RDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGILNVALRDLAKDLGEATV
LMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAESGAHVVGPSGMMDGQVA
AIRDGLDAAGYIDVVILAYAAKFASAFYGPFREAVSSSLSGDRRTYQQEPGNAAEALREI
ELDLDGGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSGEYAMIRAAAANNWIDERAA
VLESLTGIRRAGADIVLTYWAVDAAGWLT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgagttcctatccgcggcagcgaccgcgccggctccgctccaccgtcgcgatg
cgccgtctggttgcgcaaacctcgttggagccaaggcatttggtgctgccgatgttcgtt
gccgacggcattgacgagccgcggccgattacctccatgccgggcgtggtacagcacacc
cgggattcgctacgtagggccgcggcagccgcggtggccgccggcgtgggtgggctgatg
cttttcggcgtgccgcgcgaccaggacaaggacggtgtcggttcggcgggcatcgacccc
gacgggatcctcaacgtcgcccttcgcgatctggccaaggacctgggtgaggccacggtg
ttgatggccgacacctgtctggacgagttcaccgaccacgggcactgcggtgtgctcgat
gaccggggccgggtcgataacgacgccaccgtggcccgctatgtggaactggctgtggcg
caagcggaatcgggcgcccacgtggtcggacccagtgggatgatggatggccaggtagcc
gcgatccgggacggtttggacgccgccggctacatcgatgtggtgatcttggcctacgcc
gcgaagtttgcttcggcgttctacggcccgttccgcgaggcggtgagctctagcctgtcc
ggggatcggcgcacctaccagcaggagccgggcaacgccgccgaggcgctgcgtgagatc
gagctcgatctcgacggaggcgccgacattgtgatggtcaaacccgcgatgggctacctc
gatgtggtggcggccgcggcggacgtctcgccggtcccggtggccgcctatcaggtctcg
ggagagtacgcgatgattcgtgcggcggcggccaataattggatcgatgagcgtgccgcg
gtgctagagtcgctgaccggtatccggcgtgccggcgccgacatcgtgctcacctactgg
gcggtagacgcggcgggctggcttacgtga

DBGET integrated database retrieval system