KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_0650cHelp
Entry
BCGMEX_0650c      CDS       T01727                                 

Gene name
echA3
Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
mbm00071  Fatty acid degradation
mbm00280  Valine, leucine and isoleucine degradation
mbm00281  Geraniol degradation
mbm00310  Lysine degradation
mbm00360  Phenylalanine metabolism
mbm00362  Benzoate degradation
mbm00380  Tryptophan metabolism
mbm00410  beta-Alanine metabolism
mbm00627  Aminobenzoate degradation
mbm00640  Propanoate metabolism
mbm00650  Butanoate metabolism
mbm00903  Limonene and pinene degradation
mbm00930  Caprolactam degradation
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
mbm01130  Biosynthesis of antibiotics
mbm01212  Fatty acid metabolism
Module
mbm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCGMEX_0650c (echA3)
   00650 Butanoate metabolism
    BCGMEX_0650c (echA3)
  Lipid metabolism
   00071 Fatty acid degradation
    BCGMEX_0650c (echA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGMEX_0650c (echA3)
   00310 Lysine degradation
    BCGMEX_0650c (echA3)
   00360 Phenylalanine metabolism
    BCGMEX_0650c (echA3)
   00380 Tryptophan metabolism
    BCGMEX_0650c (echA3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCGMEX_0650c (echA3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCGMEX_0650c (echA3)
   00281 Geraniol degradation
    BCGMEX_0650c (echA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGMEX_0650c (echA3)
   00627 Aminobenzoate degradation
    BCGMEX_0650c (echA3)
   00930 Caprolactam degradation
    BCGMEX_0650c (echA3)
Enzymes [BR:mbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCGMEX_0650c (echA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 CLP_protease Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AET17935
Position
complement(729802..730497)
Genome map
AA seq 231 aa AA seqDB search
MSDPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDDVGALVITGNGRVFSG
GFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHAIAMGAFLLSCGDHRVA
AHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKTFFGETALAAGFIDEIAL
PEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGIDGIAAEFGL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacccggtcagctatacccgcaaggattccatcgccgtcatcagtatggacgac
ggcaaggtcaacgcactgggcccggcgatgcaacaagccctcaatgcagcgatcgacaac
gcggaccgtgatgatgttggggcgctggtgatcaccggtaatggtcgggtattcagcgga
ggcttcgacctgaagatcctcacctccggtgaagtgcagcccgcgatcgacatgctcagg
ggcggcttcgagctggcgtatcgcctcttgtcctaccccaaaccggtggtgatggcgtgc
accggtcacgccatcgccatgggcgcgtttctgttgtcctgcggcgatcatcgggtggcg
gcccacgcatacaacatccaggccaatgaggtcgcgatcggcatgaccattccgtacgcg
gcgttagagatcatgaagctgcgactgacccggtcggcataccagcaggcaaccgggctg
gccaagacgttcttcggggaaaccgcgctggccgccgggtttatcgacgagatcgccctg
ccggaggtggtggtcagccgcgccgaggaagccgcacgagagttcgccggtctcaaccaa
cacgcccatgccgcgaccaagttgcgctcccgcgccgacgcgctcactgcgattcgggcc
gggatcgacgggatagcagccgagttcgggctgtaa

DBGET integrated database retrieval system