KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_0693Help
Entry
BCGMEX_0693       CDS       T01727                                 

Gene name
echA4
Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
mbm00071  Fatty acid degradation
mbm00280  Valine, leucine and isoleucine degradation
mbm00281  Geraniol degradation
mbm00310  Lysine degradation
mbm00360  Phenylalanine metabolism
mbm00362  Benzoate degradation
mbm00380  Tryptophan metabolism
mbm00410  beta-Alanine metabolism
mbm00627  Aminobenzoate degradation
mbm00640  Propanoate metabolism
mbm00650  Butanoate metabolism
mbm00903  Limonene and pinene degradation
mbm00930  Caprolactam degradation
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
mbm01130  Biosynthesis of antibiotics
mbm01212  Fatty acid metabolism
Module
mbm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCGMEX_0693 (echA4)
   00650 Butanoate metabolism
    BCGMEX_0693 (echA4)
  Lipid metabolism
   00071 Fatty acid degradation
    BCGMEX_0693 (echA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGMEX_0693 (echA4)
   00310 Lysine degradation
    BCGMEX_0693 (echA4)
   00360 Phenylalanine metabolism
    BCGMEX_0693 (echA4)
   00380 Tryptophan metabolism
    BCGMEX_0693 (echA4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCGMEX_0693 (echA4)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCGMEX_0693 (echA4)
   00281 Geraniol degradation
    BCGMEX_0693 (echA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGMEX_0693 (echA4)
   00627 Aminobenzoate degradation
    BCGMEX_0693 (echA4)
   00930 Caprolactam degradation
    BCGMEX_0693 (echA4)
Enzymes [BR:mbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCGMEX_0693 (echA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah ACP_syn_III_C DUF3756
Motif
Other DBs
NCBI-ProteinID: AET17978
Position
774866..775804
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTGRIARITFNRPEKGNAIIADTPLELSALVERADLDPGVH
VILVSGRGEGFCAGFDLSAYAEGSSSTGGGGAYQGTVLDGKTQAVNHLPNQPWDPMIDYQ
MMSRFVRGFASLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPEPADLDERTERLVARIAALPV
NQLIMVKLALNSALLQQGVATSRMVSTVFDGAARHTPEGHAFVADAVEHGFRDAVRRRDE
PFGDYGRQASRV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcgatcaggccggtcgatttcgacaacctgaagacgatgacctatgaggtc
accggtcggattgcgcggatcaccttcaaccggccggagaagggcaacgcgatcatcgca
gacaccccgctggagttgtctgctctggtggagcgtgccgatctggatccaggcgtgcat
gtcattctggtgtccggtcgcggcgagggattctgtgccggcttcgacctgtccgcctac
gccgaggggtcgtcgtcgaccgggggcggcggcgcataccaaggcacggtgctagatggc
aagacccaggccgtcaaccacctaccgaaccagccgtgggacccgatgatcgactaccag
atgatgagccggttcgtgcgcggattcgccagtctgatgcatgccgacaagccgacggtg
gtcaagatccacggctactgcgtggccggcggcaccgacatcgcgctgcacgccgatcag
gtgatcgccgccgccgacgccaagatcggctacccgcccacccgggtgtggggggtgccg
gcggcgggcctgtgggcgcaccggctcggcgaccagcgggccaaacggctgctgttcacc
ggcgattgcatcaccggcgcgcaggccgccgagtggggcctggcggtcgaggcgccggag
ccggctgacctcgacgagcggaccgagcgactggtggcccggatcgccgcactgccggtc
aatcaattgatcatggtcaagctcgcgctcaattccgctctgctgcaacagggtgtggcc
accagcaggatggtcagcaccgtgttcgacggcgccgctcggcacacacccgaggggcac
gcgtttgtcgccgacgcggtcgagcacggcttccgggatgcggtgcggcgccgtgacgag
ccgtttggcgactacggccgtcaagcatcgcgggtgtaa

DBGET integrated database retrieval system